Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway

Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway

Bibliographic Details
Main Author: Drinkwater, Nicholas John
Published: University College London (University of London) 1997
Subjects:
551
Geology
Online Access:http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.285385
id ndltd-bl.uk-oai-ethos.bl.uk-285385
record_format oai_dc
spelling ndltd-bl.uk-oai-ethos.bl.uk-2853852015-03-19T07:18:22ZQuantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north NorwayDrinkwater, Nicholas John1997551GeologyUniversity College London (University of London)http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.285385Electronic Thesis or Dissertation
collection NDLTD
sources NDLTD
topic 551
Geology
spellingShingle 551
Geology
Drinkwater, Nicholas John
Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
author Drinkwater, Nicholas John
author_facet Drinkwater, Nicholas John
author_sort Drinkwater, Nicholas John
title Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
title_short Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
title_full Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
title_fullStr Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
title_full_unstemmed Quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, Finmark, north Norway
title_sort quantitative analysis of architecture of deep-marine sheet systems in a passive margin basin-fill sequence, finmark, north norway
publisher University College London (University of London)
publishDate 1997
url http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.285385
work_keys_str_mv AT drinkwaternicholasjohn quantitativeanalysisofarchitectureofdeepmarinesheetsystemsinapassivemarginbasinfillsequencefinmarknorthnorway
_version_ 1716755539384336384

Similar Items