Combinational Watermarking for Medical Images

Digitization of medical data has become a very important part of the modern healthcare system. Data can be transmitted easily at any time to anywhere in the world using Internet to get the best diagnosis possible for a patient. This digitized medical data must be protected at all times to preserve t...

Full description

Bibliographic Details
Main Author: Chakravarthy Chinna Narayana Swamy, Thrilok
Format: Others
Published: Scholar Commons 2015
Subjects:
Online Access:http://scholarcommons.usf.edu/etd/5833
http://scholarcommons.usf.edu/cgi/viewcontent.cgi?article=7037&context=etd
id ndltd-USF-oai-scholarcommons.usf.edu-etd-7037
record_format oai_dc
spelling ndltd-USF-oai-scholarcommons.usf.edu-etd-70372018-03-28T06:01:37Z Combinational Watermarking for Medical Images Chakravarthy Chinna Narayana Swamy, Thrilok Digitization of medical data has become a very important part of the modern healthcare system. Data can be transmitted easily at any time to anywhere in the world using Internet to get the best diagnosis possible for a patient. This digitized medical data must be protected at all times to preserve the doctor-patient confidentiality. Watermarking can be used as an effective tool to achieve this. In this research project, image watermarking is performed both in the spatial domain and the frequency domain to embed a shared image with medical image data and the patient data which would include the patient identification number. For the proposed system, Structural Similarity (SSIM) is used as an index to measure the quality of the watermarking process instead of Peak Signal to Noise Ratio (PSNR) since SSIM takes into account the visual perception of the images compared to PSNR which uses the intensity levels to measure the quality of the watermarking process. The system response under ideal conditions as well as under the influence of noise were measured and the results were analyzed. 2015-01-01T08:00:00Z text application/pdf http://scholarcommons.usf.edu/etd/5833 http://scholarcommons.usf.edu/cgi/viewcontent.cgi?article=7037&context=etd default Graduate Theses and Dissertations Scholar Commons Wavelet Transform Spatial Domain Structural Similarity Normalized Correlation Shared Key Electrical and Computer Engineering
collection NDLTD
format Others
sources NDLTD
topic Wavelet Transform
Spatial Domain
Structural Similarity
Normalized Correlation
Shared Key
Electrical and Computer Engineering
spellingShingle Wavelet Transform
Spatial Domain
Structural Similarity
Normalized Correlation
Shared Key
Electrical and Computer Engineering
Chakravarthy Chinna Narayana Swamy, Thrilok
Combinational Watermarking for Medical Images
description Digitization of medical data has become a very important part of the modern healthcare system. Data can be transmitted easily at any time to anywhere in the world using Internet to get the best diagnosis possible for a patient. This digitized medical data must be protected at all times to preserve the doctor-patient confidentiality. Watermarking can be used as an effective tool to achieve this. In this research project, image watermarking is performed both in the spatial domain and the frequency domain to embed a shared image with medical image data and the patient data which would include the patient identification number. For the proposed system, Structural Similarity (SSIM) is used as an index to measure the quality of the watermarking process instead of Peak Signal to Noise Ratio (PSNR) since SSIM takes into account the visual perception of the images compared to PSNR which uses the intensity levels to measure the quality of the watermarking process. The system response under ideal conditions as well as under the influence of noise were measured and the results were analyzed.
author Chakravarthy Chinna Narayana Swamy, Thrilok
author_facet Chakravarthy Chinna Narayana Swamy, Thrilok
author_sort Chakravarthy Chinna Narayana Swamy, Thrilok
title Combinational Watermarking for Medical Images
title_short Combinational Watermarking for Medical Images
title_full Combinational Watermarking for Medical Images
title_fullStr Combinational Watermarking for Medical Images
title_full_unstemmed Combinational Watermarking for Medical Images
title_sort combinational watermarking for medical images
publisher Scholar Commons
publishDate 2015
url http://scholarcommons.usf.edu/etd/5833
http://scholarcommons.usf.edu/cgi/viewcontent.cgi?article=7037&context=etd
work_keys_str_mv AT chakravarthychinnanarayanaswamythrilok combinationalwatermarkingformedicalimages
_version_ 1718617520073605120