Identification of genes and gene pathways affecting fertility in male Drosophila

Drosophila females remate generating an opportunity for sperm competition. Normally the second male to mate sires the majority of progeny; however, conspecific sperm precedence is the phenomena whereby the male of the same species as the female fathers the majority of the progeny regardless of mati...

Full description

Bibliographic Details
Main Author: Levesque, Lisa
Other Authors: Civetta, Alberto (Biochemistry and Medical Genetics)
Language:en_US
Published: 2010
Subjects:
Online Access:http://hdl.handle.net/1993/3926
id ndltd-LACETR-oai-collectionscanada.gc.ca-MWU.1993-3926
record_format oai_dc
spelling ndltd-LACETR-oai-collectionscanada.gc.ca-MWU.1993-39262014-03-29T03:43:16Z Identification of genes and gene pathways affecting fertility in male Drosophila Levesque, Lisa Civetta, Alberto (Biochemistry and Medical Genetics) Whyard, Steve (Biological Sciences) Davie, Jim (Biochemistry and Medical Genetics) genetics Drosophila females remate generating an opportunity for sperm competition. Normally the second male to mate sires the majority of progeny; however, conspecific sperm precedence is the phenomena whereby the male of the same species as the female fathers the majority of the progeny regardless of mating order. I surveyed D. simulans laboratory strains carrying D. mauritiana P-element insertions (IG lines) for their ability to sire progeny when second to mate. I found significant variation in the proportion of progeny sired by IG lines, with lines showing sperm competitive breakdown (P2< 0.5). I identified two loci that account for conspecific sperm precedence between D. simulans and D. mauritiana. 81 candidate genes were identified and narrowed down the list on the basis of differences in male reproductive tract gene expression to five (P< 0.05) or eight (P<0.1) genes. A larger concentration of differentially regulated genes within the 89B position was found. Using coding sequence data I identified 10 genes as candidate conspecific male precedence genes. Genes in the 89B region come to light as candidates for future functional studies of conspecific male precedence. 2010-04-08T20:19:11Z 2010-04-08T20:19:11Z 2010-04-08T20:19:11Z http://hdl.handle.net/1993/3926 en_US
collection NDLTD
language en_US
sources NDLTD
topic genetics
spellingShingle genetics
Levesque, Lisa
Identification of genes and gene pathways affecting fertility in male Drosophila
description Drosophila females remate generating an opportunity for sperm competition. Normally the second male to mate sires the majority of progeny; however, conspecific sperm precedence is the phenomena whereby the male of the same species as the female fathers the majority of the progeny regardless of mating order. I surveyed D. simulans laboratory strains carrying D. mauritiana P-element insertions (IG lines) for their ability to sire progeny when second to mate. I found significant variation in the proportion of progeny sired by IG lines, with lines showing sperm competitive breakdown (P2< 0.5). I identified two loci that account for conspecific sperm precedence between D. simulans and D. mauritiana. 81 candidate genes were identified and narrowed down the list on the basis of differences in male reproductive tract gene expression to five (P< 0.05) or eight (P<0.1) genes. A larger concentration of differentially regulated genes within the 89B position was found. Using coding sequence data I identified 10 genes as candidate conspecific male precedence genes. Genes in the 89B region come to light as candidates for future functional studies of conspecific male precedence.
author2 Civetta, Alberto (Biochemistry and Medical Genetics)
author_facet Civetta, Alberto (Biochemistry and Medical Genetics)
Levesque, Lisa
author Levesque, Lisa
author_sort Levesque, Lisa
title Identification of genes and gene pathways affecting fertility in male Drosophila
title_short Identification of genes and gene pathways affecting fertility in male Drosophila
title_full Identification of genes and gene pathways affecting fertility in male Drosophila
title_fullStr Identification of genes and gene pathways affecting fertility in male Drosophila
title_full_unstemmed Identification of genes and gene pathways affecting fertility in male Drosophila
title_sort identification of genes and gene pathways affecting fertility in male drosophila
publishDate 2010
url http://hdl.handle.net/1993/3926
work_keys_str_mv AT levesquelisa identificationofgenesandgenepathwaysaffectingfertilityinmaledrosophila
_version_ 1716658086613090304