Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports

Objective: To summarize and analyze the manifestations of stimulator of interferon genes (STING)-associated vasculopathy with onset in infancy (SAVI).Methods: A systematic literature review was performed including cases from January 1, 2014, to February 1, 2020, using PubMed, OVID, CNKI, and WanFang...

Full description

Bibliographic Details
Main Authors: YunFan Dai, XiuYun Liu, ZhiPeng Zhao, JianXin He, QingQin Yin
Format: Article
Language:English
Published: Frontiers Media S.A. 2020-12-01
Series:Frontiers in Pediatrics
Subjects:
Online Access:https://www.frontiersin.org/articles/10.3389/fped.2020.577918/full
id doaj-fa86aaee08e24b1ab44c2343bfe9a22d
record_format Article
spelling doaj-fa86aaee08e24b1ab44c2343bfe9a22d2020-12-23T10:37:26ZengFrontiers Media S.A.Frontiers in Pediatrics2296-23602020-12-01810.3389/fped.2020.577918577918Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case ReportsYunFan DaiXiuYun LiuZhiPeng ZhaoJianXin HeQingQin YinObjective: To summarize and analyze the manifestations of stimulator of interferon genes (STING)-associated vasculopathy with onset in infancy (SAVI).Methods: A systematic literature review was performed including cases from January 1, 2014, to February 1, 2020, using PubMed, OVID, CNKI, and WanFang. This included all the literature containing comparatively complete clinical data. Statistical analysis was performed using SPSS 20.0 to analyze the difference in age of onset, severity of skin lesions, and respiratory symptoms between SAVI patients with p.N154S and p.V155M mutations.Results: A total of 25 papers were included reporting on 51 individuals, of whom 17 had familiar inheritance of their mutation. Patients included 27 males and 24 females, and 8 fatal cases were observed. A total of 10 mutation sites have been reported in the STING gene, with p.V155M being the most prevalent. We identified SAVI as an early-onset disease with a median age of onset of 3 months after birth. Skin lesions were the most common symptoms of SAVI, found in 94.1% (48/51) of patients, while 76% (19/25) who had undergone a skin biopsy showed vasculopathy. Involvement of the lungs was identified in 68.6% (35/51) of patients, while only 22.2% (4/18) who had undergone a lung biopsy showed vasculopathy. Of 20 patients, 19 had increased immunoglobulin, mainly IgG. Furthermore, 45.1% (23/51) of patients had a positive low titer or were transiently positive for antinuclear antibodies. Of the 18 patients treated with JAK inhibitors, 6 relapsed and 2 died of acute respiratory failure caused by viral infection. Patients with p.N154S mutation had an earlier disease onset (p = 0.002) and more severe skin lesions (p < 0.001) than those patients with p.V155M mutation.Conclusion: SAVI is an early-onset disease accompanied by skin and lung lesions whose clinical presentation varies among patients with different genotypes. Therapeutic effects of JAK inhibitors are unsatisfactory.https://www.frontiersin.org/articles/10.3389/fped.2020.577918/fullSTING-associated vasculopathy with onset in infancyinterstitial lung diseaseinterferon genessystematic reviewchildren
collection DOAJ
language English
format Article
sources DOAJ
author YunFan Dai
XiuYun Liu
ZhiPeng Zhao
JianXin He
QingQin Yin
spellingShingle YunFan Dai
XiuYun Liu
ZhiPeng Zhao
JianXin He
QingQin Yin
Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
Frontiers in Pediatrics
STING-associated vasculopathy with onset in infancy
interstitial lung disease
interferon genes
systematic review
children
author_facet YunFan Dai
XiuYun Liu
ZhiPeng Zhao
JianXin He
QingQin Yin
author_sort YunFan Dai
title Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
title_short Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
title_full Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
title_fullStr Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
title_full_unstemmed Stimulator of Interferon Genes-Associated Vasculopathy With Onset in Infancy: A Systematic Review of Case Reports
title_sort stimulator of interferon genes-associated vasculopathy with onset in infancy: a systematic review of case reports
publisher Frontiers Media S.A.
series Frontiers in Pediatrics
issn 2296-2360
publishDate 2020-12-01
description Objective: To summarize and analyze the manifestations of stimulator of interferon genes (STING)-associated vasculopathy with onset in infancy (SAVI).Methods: A systematic literature review was performed including cases from January 1, 2014, to February 1, 2020, using PubMed, OVID, CNKI, and WanFang. This included all the literature containing comparatively complete clinical data. Statistical analysis was performed using SPSS 20.0 to analyze the difference in age of onset, severity of skin lesions, and respiratory symptoms between SAVI patients with p.N154S and p.V155M mutations.Results: A total of 25 papers were included reporting on 51 individuals, of whom 17 had familiar inheritance of their mutation. Patients included 27 males and 24 females, and 8 fatal cases were observed. A total of 10 mutation sites have been reported in the STING gene, with p.V155M being the most prevalent. We identified SAVI as an early-onset disease with a median age of onset of 3 months after birth. Skin lesions were the most common symptoms of SAVI, found in 94.1% (48/51) of patients, while 76% (19/25) who had undergone a skin biopsy showed vasculopathy. Involvement of the lungs was identified in 68.6% (35/51) of patients, while only 22.2% (4/18) who had undergone a lung biopsy showed vasculopathy. Of 20 patients, 19 had increased immunoglobulin, mainly IgG. Furthermore, 45.1% (23/51) of patients had a positive low titer or were transiently positive for antinuclear antibodies. Of the 18 patients treated with JAK inhibitors, 6 relapsed and 2 died of acute respiratory failure caused by viral infection. Patients with p.N154S mutation had an earlier disease onset (p = 0.002) and more severe skin lesions (p < 0.001) than those patients with p.V155M mutation.Conclusion: SAVI is an early-onset disease accompanied by skin and lung lesions whose clinical presentation varies among patients with different genotypes. Therapeutic effects of JAK inhibitors are unsatisfactory.
topic STING-associated vasculopathy with onset in infancy
interstitial lung disease
interferon genes
systematic review
children
url https://www.frontiersin.org/articles/10.3389/fped.2020.577918/full
work_keys_str_mv AT yunfandai stimulatorofinterferongenesassociatedvasculopathywithonsetininfancyasystematicreviewofcasereports
AT xiuyunliu stimulatorofinterferongenesassociatedvasculopathywithonsetininfancyasystematicreviewofcasereports
AT zhipengzhao stimulatorofinterferongenesassociatedvasculopathywithonsetininfancyasystematicreviewofcasereports
AT jianxinhe stimulatorofinterferongenesassociatedvasculopathywithonsetininfancyasystematicreviewofcasereports
AT qingqinyin stimulatorofinterferongenesassociatedvasculopathywithonsetininfancyasystematicreviewofcasereports
_version_ 1724372735550816256