Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam

Background Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequenc...

Full description

Bibliographic Details
Main Authors: Trang Thu Le, Thach Xuan Tran, Long Phi Trieu, Christopher M. Austin, Huong Minh Nguyen, Dong Van Quyen
Format: Article
Language:English
Published: PeerJ Inc. 2020-07-01
Series:PeerJ
Subjects:
Online Access:https://peerj.com/articles/9502.pdf
id doaj-f1327a73a89a4bfd89d2dc57777a4089
record_format Article
spelling doaj-f1327a73a89a4bfd89d2dc57777a40892020-11-25T03:06:06ZengPeerJ Inc.PeerJ2167-83592020-07-018e950210.7717/peerj.9502Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in VietnamTrang Thu Le0Thach Xuan Tran1Long Phi Trieu2Christopher M. Austin3Huong Minh Nguyen4Dong Van Quyen5Laboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Microbiology, Military Institute of Preventive Medicine, Hanoi, VietnamDeakin Genomics Centre, Deakin University, Geelong, Victoria, AustraliaLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamBackground Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequencing (WGS) has proven useful for meningococcal disease surveillance and guiding preventative vaccination programs. Previously, we characterized key genetic and epidemiological features of an invasive N. meningitidis B isolate from a military unit in Vietnam. Here, we extend these findings by sequencing two additional invasive N. meningitidis B isolated from cerebrospinal fluid (CSF) of two meningitis cases at another military unit and compared their genomic sequences and features. We also report the sequence types and antigenic profiles of 25 historical and more recently emerged N. meningitidis isolates from these units and other units in proximity. Methods Strains were sequenced using the Illumina HiSeq platform, de novo assembled and annotated. Genomes were compared within and between military units, as well as against the global N. meningitidis collection and other isolates from the Southeast Asia region using PubMLST. Variations at the nucleotide level were determined, and phylogenetic relationships were estimated. Antigenic genotypes and vaccine coverage were analyzed using gMATS and PubMLST. Susceptibility of isolates against commonly used antibiotic agents was examined using E-test. Results Genome comparison revealed a high level of similarity among isolates both within and between units. All isolates showed resistance to chloramphenicol and carried identical catP gene with other Southeast Asian isolates, suggesting a common lineage. Their antigenic genotypes predicted no coverage by either Bexsero®or Trumenba®, and nucleotide variation analysis revealed diverse new, unassigned alleles at multiple virulence loci of all strains. Groups of singleton and unique novel sequence types extending beyond individual camps were found from epidemiological data of 25 other isolates. Our results add to the sparse published molecular data of N. meningitidis in the military units in Vietnam, highlight their diversity, distinct genetic features and antibiotic resistance pattern, and emphasize the need for further studies on the molecular characteristics of N. meningitidis in Vietnam.https://peerj.com/articles/9502.pdfNeisseria meningitidisWhole genome sequencingEpidemiological characterizationAntibiotic resistanceMilitaryVietnam
collection DOAJ
language English
format Article
sources DOAJ
author Trang Thu Le
Thach Xuan Tran
Long Phi Trieu
Christopher M. Austin
Huong Minh Nguyen
Dong Van Quyen
spellingShingle Trang Thu Le
Thach Xuan Tran
Long Phi Trieu
Christopher M. Austin
Huong Minh Nguyen
Dong Van Quyen
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
PeerJ
Neisseria meningitidis
Whole genome sequencing
Epidemiological characterization
Antibiotic resistance
Military
Vietnam
author_facet Trang Thu Le
Thach Xuan Tran
Long Phi Trieu
Christopher M. Austin
Huong Minh Nguyen
Dong Van Quyen
author_sort Trang Thu Le
title Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
title_short Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
title_full Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
title_fullStr Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
title_full_unstemmed Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
title_sort genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of neisseria meningitidis in military camps in vietnam
publisher PeerJ Inc.
series PeerJ
issn 2167-8359
publishDate 2020-07-01
description Background Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequencing (WGS) has proven useful for meningococcal disease surveillance and guiding preventative vaccination programs. Previously, we characterized key genetic and epidemiological features of an invasive N. meningitidis B isolate from a military unit in Vietnam. Here, we extend these findings by sequencing two additional invasive N. meningitidis B isolated from cerebrospinal fluid (CSF) of two meningitis cases at another military unit and compared their genomic sequences and features. We also report the sequence types and antigenic profiles of 25 historical and more recently emerged N. meningitidis isolates from these units and other units in proximity. Methods Strains were sequenced using the Illumina HiSeq platform, de novo assembled and annotated. Genomes were compared within and between military units, as well as against the global N. meningitidis collection and other isolates from the Southeast Asia region using PubMLST. Variations at the nucleotide level were determined, and phylogenetic relationships were estimated. Antigenic genotypes and vaccine coverage were analyzed using gMATS and PubMLST. Susceptibility of isolates against commonly used antibiotic agents was examined using E-test. Results Genome comparison revealed a high level of similarity among isolates both within and between units. All isolates showed resistance to chloramphenicol and carried identical catP gene with other Southeast Asian isolates, suggesting a common lineage. Their antigenic genotypes predicted no coverage by either Bexsero®or Trumenba®, and nucleotide variation analysis revealed diverse new, unassigned alleles at multiple virulence loci of all strains. Groups of singleton and unique novel sequence types extending beyond individual camps were found from epidemiological data of 25 other isolates. Our results add to the sparse published molecular data of N. meningitidis in the military units in Vietnam, highlight their diversity, distinct genetic features and antibiotic resistance pattern, and emphasize the need for further studies on the molecular characteristics of N. meningitidis in Vietnam.
topic Neisseria meningitidis
Whole genome sequencing
Epidemiological characterization
Antibiotic resistance
Military
Vietnam
url https://peerj.com/articles/9502.pdf
work_keys_str_mv AT trangthule genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
AT thachxuantran genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
AT longphitrieu genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
AT christophermaustin genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
AT huongminhnguyen genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
AT dongvanquyen genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam
_version_ 1724675402051354624