Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam
Background Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequenc...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
PeerJ Inc.
2020-07-01
|
Series: | PeerJ |
Subjects: | |
Online Access: | https://peerj.com/articles/9502.pdf |
id |
doaj-f1327a73a89a4bfd89d2dc57777a4089 |
---|---|
record_format |
Article |
spelling |
doaj-f1327a73a89a4bfd89d2dc57777a40892020-11-25T03:06:06ZengPeerJ Inc.PeerJ2167-83592020-07-018e950210.7717/peerj.9502Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in VietnamTrang Thu Le0Thach Xuan Tran1Long Phi Trieu2Christopher M. Austin3Huong Minh Nguyen4Dong Van Quyen5Laboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Microbiology, Military Institute of Preventive Medicine, Hanoi, VietnamDeakin Genomics Centre, Deakin University, Geelong, Victoria, AustraliaLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamLaboratory of Molecular Microbiology, Institute of Biotechnology, Vietnam Academy of Science and Technology, Hanoi, VietnamBackground Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequencing (WGS) has proven useful for meningococcal disease surveillance and guiding preventative vaccination programs. Previously, we characterized key genetic and epidemiological features of an invasive N. meningitidis B isolate from a military unit in Vietnam. Here, we extend these findings by sequencing two additional invasive N. meningitidis B isolated from cerebrospinal fluid (CSF) of two meningitis cases at another military unit and compared their genomic sequences and features. We also report the sequence types and antigenic profiles of 25 historical and more recently emerged N. meningitidis isolates from these units and other units in proximity. Methods Strains were sequenced using the Illumina HiSeq platform, de novo assembled and annotated. Genomes were compared within and between military units, as well as against the global N. meningitidis collection and other isolates from the Southeast Asia region using PubMLST. Variations at the nucleotide level were determined, and phylogenetic relationships were estimated. Antigenic genotypes and vaccine coverage were analyzed using gMATS and PubMLST. Susceptibility of isolates against commonly used antibiotic agents was examined using E-test. Results Genome comparison revealed a high level of similarity among isolates both within and between units. All isolates showed resistance to chloramphenicol and carried identical catP gene with other Southeast Asian isolates, suggesting a common lineage. Their antigenic genotypes predicted no coverage by either Bexsero®or Trumenba®, and nucleotide variation analysis revealed diverse new, unassigned alleles at multiple virulence loci of all strains. Groups of singleton and unique novel sequence types extending beyond individual camps were found from epidemiological data of 25 other isolates. Our results add to the sparse published molecular data of N. meningitidis in the military units in Vietnam, highlight their diversity, distinct genetic features and antibiotic resistance pattern, and emphasize the need for further studies on the molecular characteristics of N. meningitidis in Vietnam.https://peerj.com/articles/9502.pdfNeisseria meningitidisWhole genome sequencingEpidemiological characterizationAntibiotic resistanceMilitaryVietnam |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Trang Thu Le Thach Xuan Tran Long Phi Trieu Christopher M. Austin Huong Minh Nguyen Dong Van Quyen |
spellingShingle |
Trang Thu Le Thach Xuan Tran Long Phi Trieu Christopher M. Austin Huong Minh Nguyen Dong Van Quyen Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam PeerJ Neisseria meningitidis Whole genome sequencing Epidemiological characterization Antibiotic resistance Military Vietnam |
author_facet |
Trang Thu Le Thach Xuan Tran Long Phi Trieu Christopher M. Austin Huong Minh Nguyen Dong Van Quyen |
author_sort |
Trang Thu Le |
title |
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam |
title_short |
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam |
title_full |
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam |
title_fullStr |
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam |
title_full_unstemmed |
Genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of Neisseria meningitidis in military camps in Vietnam |
title_sort |
genotypic characterization and genome comparison reveal insights into potential vaccine coverage and genealogy of neisseria meningitidis in military camps in vietnam |
publisher |
PeerJ Inc. |
series |
PeerJ |
issn |
2167-8359 |
publishDate |
2020-07-01 |
description |
Background Neisseria meningitidis remains the main cause of sporadic meningitis and sepsis in military camps in Vietnam. Yet, very limited molecular data of their genotypic and epidemiological characteristics are available from Vietnam, and particularly the military environment. Whole genome sequencing (WGS) has proven useful for meningococcal disease surveillance and guiding preventative vaccination programs. Previously, we characterized key genetic and epidemiological features of an invasive N. meningitidis B isolate from a military unit in Vietnam. Here, we extend these findings by sequencing two additional invasive N. meningitidis B isolated from cerebrospinal fluid (CSF) of two meningitis cases at another military unit and compared their genomic sequences and features. We also report the sequence types and antigenic profiles of 25 historical and more recently emerged N. meningitidis isolates from these units and other units in proximity. Methods Strains were sequenced using the Illumina HiSeq platform, de novo assembled and annotated. Genomes were compared within and between military units, as well as against the global N. meningitidis collection and other isolates from the Southeast Asia region using PubMLST. Variations at the nucleotide level were determined, and phylogenetic relationships were estimated. Antigenic genotypes and vaccine coverage were analyzed using gMATS and PubMLST. Susceptibility of isolates against commonly used antibiotic agents was examined using E-test. Results Genome comparison revealed a high level of similarity among isolates both within and between units. All isolates showed resistance to chloramphenicol and carried identical catP gene with other Southeast Asian isolates, suggesting a common lineage. Their antigenic genotypes predicted no coverage by either Bexsero®or Trumenba®, and nucleotide variation analysis revealed diverse new, unassigned alleles at multiple virulence loci of all strains. Groups of singleton and unique novel sequence types extending beyond individual camps were found from epidemiological data of 25 other isolates. Our results add to the sparse published molecular data of N. meningitidis in the military units in Vietnam, highlight their diversity, distinct genetic features and antibiotic resistance pattern, and emphasize the need for further studies on the molecular characteristics of N. meningitidis in Vietnam. |
topic |
Neisseria meningitidis Whole genome sequencing Epidemiological characterization Antibiotic resistance Military Vietnam |
url |
https://peerj.com/articles/9502.pdf |
work_keys_str_mv |
AT trangthule genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam AT thachxuantran genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam AT longphitrieu genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam AT christophermaustin genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam AT huongminhnguyen genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam AT dongvanquyen genotypiccharacterizationandgenomecomparisonrevealinsightsintopotentialvaccinecoverageandgenealogyofneisseriameningitidisinmilitarycampsinvietnam |
_version_ |
1724675402051354624 |