Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct

Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct

The epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus o...

Full description

Bibliographic Details
Main Authors: Jean A. Monro, John McLaren-Howard, Mussadiq Shah, Peter O. O. Julu, Basant K. Puri
Format: Article
Language:English
Published: Hindawi Limited 2017-01-01
Series:Case Reports in Medicine
Online Access:http://dx.doi.org/10.1155/2017/3512353
id doaj-e192e53ed74d4422863c83d76afd742b
record_format Article
spelling doaj-e192e53ed74d4422863c83d76afd742b2020-11-25T00:43:25ZengHindawi LimitedCase Reports in Medicine1687-96271687-96352017-01-01201710.1155/2017/35123533512353Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA AdductJean A. Monro0John McLaren-Howard1Mussadiq Shah2Peter O. O. Julu3Basant K. Puri4Breakspear Medical Group, Hemel Hempstead, Hertfordshire, UKAcumen, P.O. Box 129, Tiverton, Devon, UKBreakspear Medical Group, Hemel Hempstead, Hertfordshire, UKBreakspear Medical Group, Hemel Hempstead, Hertfordshire, UKDepartment of Medicine, Imperial College London, London, UKThe epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus of the N-formyl peptide receptors was associated with recovery from cogwheel rigidity and akinesia as well as with improvement in vibration sense and olfactory perception.http://dx.doi.org/10.1155/2017/3512353
collection DOAJ
language English
format Article
sources DOAJ
author Jean A. Monro
John McLaren-Howard
Mussadiq Shah
Peter O. O. Julu
Basant K. Puri
spellingShingle Jean A. Monro
John McLaren-Howard
Mussadiq Shah
Peter O. O. Julu
Basant K. Puri
Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
Case Reports in Medicine
author_facet Jean A. Monro
John McLaren-Howard
Mussadiq Shah
Peter O. O. Julu
Basant K. Puri
author_sort Jean A. Monro
title Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_short Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_full Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_fullStr Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_full_unstemmed Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_sort recovery from cogwheel rigidity and akinesia and improvement in vibration sense and olfactory perception following removal of an epoxy-oleic acid dna adduct
publisher Hindawi Limited
series Case Reports in Medicine
issn 1687-9627
1687-9635
publishDate 2017-01-01
description The epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus of the N-formyl peptide receptors was associated with recovery from cogwheel rigidity and akinesia as well as with improvement in vibration sense and olfactory perception.
url http://dx.doi.org/10.1155/2017/3512353
work_keys_str_mv AT jeanamonro recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT johnmclarenhoward recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT mussadiqshah recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT peteroojulu recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT basantkpuri recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
_version_ 1725278446152581120

Similar Items