Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon

Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portio...

Full description

Bibliographic Details
Main Authors: Nathalie Gabra, Manon Belair, Tareck Ayad
Format: Article
Language:English
Published: Hindawi Limited 2013-01-01
Series:Case Reports in Otolaryngology
Online Access:http://dx.doi.org/10.1155/2013/912628
id doaj-d65e981ff2fe4ff78c48ea9d44bd2162
record_format Article
spelling doaj-d65e981ff2fe4ff78c48ea9d44bd21622020-11-25T00:52:23ZengHindawi LimitedCase Reports in Otolaryngology2090-67652090-67732013-01-01201310.1155/2013/912628912628Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal PhlegmonNathalie Gabra0Manon Belair1Tareck Ayad2University of Montreal, CanadaDepartment of Radiology, Notre-Dame Hospital, University of Montreal Hospitals (CHUM), Montreal, QC, H2L 4M1, CanadaDivision of Otolaryngology—Head and Neck Surgery, Notre-Dame Hospital, University of Montreal Hospitals (CHUM), Montreal, QC, H2L 4M1, CanadaBackground. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety.http://dx.doi.org/10.1155/2013/912628
collection DOAJ
language English
format Article
sources DOAJ
author Nathalie Gabra
Manon Belair
Tareck Ayad
spellingShingle Nathalie Gabra
Manon Belair
Tareck Ayad
Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
Case Reports in Otolaryngology
author_facet Nathalie Gabra
Manon Belair
Tareck Ayad
author_sort Nathalie Gabra
title Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_short Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_full Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_fullStr Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_full_unstemmed Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_sort retropharyngeal calcific tendinitis mimicking a retropharyngeal phlegmon
publisher Hindawi Limited
series Case Reports in Otolaryngology
issn 2090-6765
2090-6773
publishDate 2013-01-01
description Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety.
url http://dx.doi.org/10.1155/2013/912628
work_keys_str_mv AT nathaliegabra retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon
AT manonbelair retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon
AT tareckayad retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon
_version_ 1725242609337630720