Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.

The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Eu...

Full description

Bibliographic Details
Main Authors: Sharyn J Goldstien, Lise Dupont, Frédérique Viard, Paul J Hallas, Teruaki Nishikawa, David R Schiel, Neil J Gemmell, John D D Bishop
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2011-02-01
Series:PLoS ONE
Online Access:https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/21364988/pdf/?tool=EBI
id doaj-d05a8ec6cdd04786bad5676905f88d8f
record_format Article
spelling doaj-d05a8ec6cdd04786bad5676905f88d8f2021-03-04T02:04:18ZengPublic Library of Science (PLoS)PLoS ONE1932-62032011-02-0162e1675510.1371/journal.pone.0016755Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.Sharyn J GoldstienLise DupontFrédérique ViardPaul J HallasTeruaki NishikawaDavid R SchielNeil J GemmellJohn D D BishopThe solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/21364988/pdf/?tool=EBI
collection DOAJ
language English
format Article
sources DOAJ
author Sharyn J Goldstien
Lise Dupont
Frédérique Viard
Paul J Hallas
Teruaki Nishikawa
David R Schiel
Neil J Gemmell
John D D Bishop
spellingShingle Sharyn J Goldstien
Lise Dupont
Frédérique Viard
Paul J Hallas
Teruaki Nishikawa
David R Schiel
Neil J Gemmell
John D D Bishop
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
PLoS ONE
author_facet Sharyn J Goldstien
Lise Dupont
Frédérique Viard
Paul J Hallas
Teruaki Nishikawa
David R Schiel
Neil J Gemmell
John D D Bishop
author_sort Sharyn J Goldstien
title Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_short Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_full Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_fullStr Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_full_unstemmed Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_sort global phylogeography of the widely introduced north west pacific ascidian styela clava.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2011-02-01
description The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.
url https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/21364988/pdf/?tool=EBI
work_keys_str_mv AT sharynjgoldstien globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT lisedupont globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT frederiqueviard globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT pauljhallas globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT teruakinishikawa globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT davidrschiel globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT neiljgemmell globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT johnddbishop globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
_version_ 1714809054499438592