Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.

BACKGROUND:The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ-induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studie...

Full description

Bibliographic Details
Main Authors: Fucheng Cai, Xiyue Xiao, Xun Niu, Yi Zhong
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2017-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC5332095?pdf=render
id doaj-cf030ccea7e547dea4b164512eea40b9
record_format Article
spelling doaj-cf030ccea7e547dea4b164512eea40b92020-11-25T01:22:52ZengPublic Library of Science (PLoS)PLoS ONE1932-62032017-01-01123e017319410.1371/journal.pone.0173194Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.Fucheng CaiXiyue XiaoXun NiuYi ZhongBACKGROUND:The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ-induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studies are inconsistent. Hence, the present study aimed to evaluate the association between the promoter methylation of DAPK gene and HNSCC. METHODS:Relevant studies were systematically searched in PubMed, Web of Science, Ovid, and Embase. The association between DAPK promoter methylation and HNSCC was assessed by odds ratio (ORs) and 95% confidence intervals (CI). To evaluate the potential sources of heterogeneity, we conducted the meta-regression analysis and subgroup analysis. RESULTS:Eighteen studies were finally included in the meta-analysis. The frequency of DAPK promoter methylation in patients with HNSCC was 4.09-fold higher than the non-cancerous controls (OR = 3.96, 95%CI = 2.26-6.95). A significant association between DAPK promoter methylation and HNSCC was found among the Asian region and the Non-Asia region (Asian region, OR = 4.43, 95% CI = 2.29-8.58; Non-Asia region, OR = 3.39, 95% CI = 1.18-9.78). In the control source, the significant association between DAPK promoter methylation and HNSCC was seen among the autologous group and the heterogeneous group (autologous group, OR = 2.71, 95% CI = 1.49-4.93; heterogeneous group, OR = 9.50, 95% CI = 2.98-30.27). DAPK promoter methylation was significantly correlated with alcohol status (OR = 1.85, 95% CI = 1.07-3.21). CONCLUSION:The results of this meta-analysis suggested that aberrant methylation of DAPK promoter was associated with HNSCC.http://europepmc.org/articles/PMC5332095?pdf=render
collection DOAJ
language English
format Article
sources DOAJ
author Fucheng Cai
Xiyue Xiao
Xun Niu
Yi Zhong
spellingShingle Fucheng Cai
Xiyue Xiao
Xun Niu
Yi Zhong
Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
PLoS ONE
author_facet Fucheng Cai
Xiyue Xiao
Xun Niu
Yi Zhong
author_sort Fucheng Cai
title Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
title_short Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
title_full Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
title_fullStr Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
title_full_unstemmed Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis.
title_sort association between promoter methylation of dapk gene and hnscc: a meta-analysis.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2017-01-01
description BACKGROUND:The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ-induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studies are inconsistent. Hence, the present study aimed to evaluate the association between the promoter methylation of DAPK gene and HNSCC. METHODS:Relevant studies were systematically searched in PubMed, Web of Science, Ovid, and Embase. The association between DAPK promoter methylation and HNSCC was assessed by odds ratio (ORs) and 95% confidence intervals (CI). To evaluate the potential sources of heterogeneity, we conducted the meta-regression analysis and subgroup analysis. RESULTS:Eighteen studies were finally included in the meta-analysis. The frequency of DAPK promoter methylation in patients with HNSCC was 4.09-fold higher than the non-cancerous controls (OR = 3.96, 95%CI = 2.26-6.95). A significant association between DAPK promoter methylation and HNSCC was found among the Asian region and the Non-Asia region (Asian region, OR = 4.43, 95% CI = 2.29-8.58; Non-Asia region, OR = 3.39, 95% CI = 1.18-9.78). In the control source, the significant association between DAPK promoter methylation and HNSCC was seen among the autologous group and the heterogeneous group (autologous group, OR = 2.71, 95% CI = 1.49-4.93; heterogeneous group, OR = 9.50, 95% CI = 2.98-30.27). DAPK promoter methylation was significantly correlated with alcohol status (OR = 1.85, 95% CI = 1.07-3.21). CONCLUSION:The results of this meta-analysis suggested that aberrant methylation of DAPK promoter was associated with HNSCC.
url http://europepmc.org/articles/PMC5332095?pdf=render
work_keys_str_mv AT fuchengcai associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT xiyuexiao associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT xunniu associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT yizhong associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
_version_ 1725125055617171456