<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
<p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
BMC
2011-05-01
|
Series: | BMC Microbiology |
Subjects: | |
Online Access: | http://www.biomedcentral.com/1471-2180/11/122 |
id |
doaj-c3f343a6e6e643cfa1cee7f668ebb194 |
---|---|
record_format |
Article |
spelling |
doaj-c3f343a6e6e643cfa1cee7f668ebb1942020-11-24T23:46:04ZengBMCBMC Microbiology1471-21802011-05-0111112210.1186/1471-2180-11-122<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cellsVágvölgyi CsabaHamari ZsuzsannaNémeth TiborFilkor KataNagy IstvánGácser Attila<p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself into an opportunistic pathogen. <it>Candida</it>-derived lipase has been identified as potential virulence factor. Even though cellular components of the innate immune response, such as dendritic cells, represent the first line of defense against invading pathogens, little is known about the interaction of these cells with invading <it>C. parapsilosis</it>. Thus, the aim of our study was to assess the function of dendritic cells in fighting <it>C. parapsilosis </it>and to determine the role that <it>C. parapsilosis</it>-derived lipase plays in the interaction with dendritic cells.</p> <p>Results</p> <p>Monocyte-derived immature and mature dendritic cells (iDCs and mDCs, respectively) co-cultured with live wild type or lipase deficient <it>C. parapsilosis </it>strains were studied to determine the phagocytic capacity and killing efficiency of host cells. We determined that both iDCs and mDCs efficiently phagocytosed and killed <it>C. parapsilosis</it>, furthermore our results show that the phagocytic and fungicidal activities of both iDCs and mDCs are more potent for lipase deficient compared to wild type yeast cells. In addition, the lipase deficient <it>C. parapsilosis </it>cells induce higher gene expression and protein secretion of proinflammatory cytokines and chemokines in both DC types relative to the effect of co-culture with wild type yeast cells.</p> <p>Conclusions</p> <p>Our results show that DCs are activated by exposure to <it>C. parapsilosis</it>, as shown by increased phagocytosis, killing and proinflammatory protein secretion. Moreover, these data strongly suggest that <it>C. parapsilosis </it>derived lipase has a protective role during yeast:DC interactions, since lipase production in wt yeast cells decreased the phagocytic capacity and killing efficiency of host cells and downregulated the expression of host effector molecules.</p> http://www.biomedcentral.com/1471-2180/11/122<it>Candida</it>dendritic cellinnate immunitysecreted lipase |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Vágvölgyi Csaba Hamari Zsuzsanna Németh Tibor Filkor Kata Nagy István Gácser Attila |
spellingShingle |
Vágvölgyi Csaba Hamari Zsuzsanna Németh Tibor Filkor Kata Nagy István Gácser Attila <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells BMC Microbiology <it>Candida</it> dendritic cell innate immunity secreted lipase |
author_facet |
Vágvölgyi Csaba Hamari Zsuzsanna Németh Tibor Filkor Kata Nagy István Gácser Attila |
author_sort |
Vágvölgyi Csaba |
title |
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
title_short |
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
title_full |
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
title_fullStr |
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
title_full_unstemmed |
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
title_sort |
<it>in vitro </it>interactions of <it>candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells |
publisher |
BMC |
series |
BMC Microbiology |
issn |
1471-2180 |
publishDate |
2011-05-01 |
description |
<p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself into an opportunistic pathogen. <it>Candida</it>-derived lipase has been identified as potential virulence factor. Even though cellular components of the innate immune response, such as dendritic cells, represent the first line of defense against invading pathogens, little is known about the interaction of these cells with invading <it>C. parapsilosis</it>. Thus, the aim of our study was to assess the function of dendritic cells in fighting <it>C. parapsilosis </it>and to determine the role that <it>C. parapsilosis</it>-derived lipase plays in the interaction with dendritic cells.</p> <p>Results</p> <p>Monocyte-derived immature and mature dendritic cells (iDCs and mDCs, respectively) co-cultured with live wild type or lipase deficient <it>C. parapsilosis </it>strains were studied to determine the phagocytic capacity and killing efficiency of host cells. We determined that both iDCs and mDCs efficiently phagocytosed and killed <it>C. parapsilosis</it>, furthermore our results show that the phagocytic and fungicidal activities of both iDCs and mDCs are more potent for lipase deficient compared to wild type yeast cells. In addition, the lipase deficient <it>C. parapsilosis </it>cells induce higher gene expression and protein secretion of proinflammatory cytokines and chemokines in both DC types relative to the effect of co-culture with wild type yeast cells.</p> <p>Conclusions</p> <p>Our results show that DCs are activated by exposure to <it>C. parapsilosis</it>, as shown by increased phagocytosis, killing and proinflammatory protein secretion. Moreover, these data strongly suggest that <it>C. parapsilosis </it>derived lipase has a protective role during yeast:DC interactions, since lipase production in wt yeast cells decreased the phagocytic capacity and killing efficiency of host cells and downregulated the expression of host effector molecules.</p> |
topic |
<it>Candida</it> dendritic cell innate immunity secreted lipase |
url |
http://www.biomedcentral.com/1471-2180/11/122 |
work_keys_str_mv |
AT vagvolgyicsaba itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells AT hamarizsuzsanna itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells AT nemethtibor itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells AT filkorkata itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells AT nagyistvan itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells AT gacserattila itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells |
_version_ |
1725494752463290368 |