<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells

<p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself...

Full description

Bibliographic Details
Main Authors: Vágvölgyi Csaba, Hamari Zsuzsanna, Németh Tibor, Filkor Kata, Nagy István, Gácser Attila
Format: Article
Language:English
Published: BMC 2011-05-01
Series:BMC Microbiology
Subjects:
Online Access:http://www.biomedcentral.com/1471-2180/11/122
id doaj-c3f343a6e6e643cfa1cee7f668ebb194
record_format Article
spelling doaj-c3f343a6e6e643cfa1cee7f668ebb1942020-11-24T23:46:04ZengBMCBMC Microbiology1471-21802011-05-0111112210.1186/1471-2180-11-122<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cellsVágvölgyi CsabaHamari ZsuzsannaNémeth TiborFilkor KataNagy IstvánGácser Attila<p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself into an opportunistic pathogen. <it>Candida</it>-derived lipase has been identified as potential virulence factor. Even though cellular components of the innate immune response, such as dendritic cells, represent the first line of defense against invading pathogens, little is known about the interaction of these cells with invading <it>C. parapsilosis</it>. Thus, the aim of our study was to assess the function of dendritic cells in fighting <it>C. parapsilosis </it>and to determine the role that <it>C. parapsilosis</it>-derived lipase plays in the interaction with dendritic cells.</p> <p>Results</p> <p>Monocyte-derived immature and mature dendritic cells (iDCs and mDCs, respectively) co-cultured with live wild type or lipase deficient <it>C. parapsilosis </it>strains were studied to determine the phagocytic capacity and killing efficiency of host cells. We determined that both iDCs and mDCs efficiently phagocytosed and killed <it>C. parapsilosis</it>, furthermore our results show that the phagocytic and fungicidal activities of both iDCs and mDCs are more potent for lipase deficient compared to wild type yeast cells. In addition, the lipase deficient <it>C. parapsilosis </it>cells induce higher gene expression and protein secretion of proinflammatory cytokines and chemokines in both DC types relative to the effect of co-culture with wild type yeast cells.</p> <p>Conclusions</p> <p>Our results show that DCs are activated by exposure to <it>C. parapsilosis</it>, as shown by increased phagocytosis, killing and proinflammatory protein secretion. Moreover, these data strongly suggest that <it>C. parapsilosis </it>derived lipase has a protective role during yeast:DC interactions, since lipase production in wt yeast cells decreased the phagocytic capacity and killing efficiency of host cells and downregulated the expression of host effector molecules.</p> http://www.biomedcentral.com/1471-2180/11/122<it>Candida</it>dendritic cellinnate immunitysecreted lipase
collection DOAJ
language English
format Article
sources DOAJ
author Vágvölgyi Csaba
Hamari Zsuzsanna
Németh Tibor
Filkor Kata
Nagy István
Gácser Attila
spellingShingle Vágvölgyi Csaba
Hamari Zsuzsanna
Németh Tibor
Filkor Kata
Nagy István
Gácser Attila
<it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
BMC Microbiology
<it>Candida</it>
dendritic cell
innate immunity
secreted lipase
author_facet Vágvölgyi Csaba
Hamari Zsuzsanna
Németh Tibor
Filkor Kata
Nagy István
Gácser Attila
author_sort Vágvölgyi Csaba
title <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
title_short <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
title_full <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
title_fullStr <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
title_full_unstemmed <it>In vitro </it>interactions of <it>Candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
title_sort <it>in vitro </it>interactions of <it>candida parapsilosis </it>wild type and lipase deficient mutants with human monocyte derived dendritic cells
publisher BMC
series BMC Microbiology
issn 1471-2180
publishDate 2011-05-01
description <p>Abstract</p> <p>Background</p> <p><it>Candida parapsilosis </it>typically is a commensal of human skin. However, when host immune defense is compromised or the normal microflora balance is disrupted, <it>C. parapsilosis </it>transforms itself into an opportunistic pathogen. <it>Candida</it>-derived lipase has been identified as potential virulence factor. Even though cellular components of the innate immune response, such as dendritic cells, represent the first line of defense against invading pathogens, little is known about the interaction of these cells with invading <it>C. parapsilosis</it>. Thus, the aim of our study was to assess the function of dendritic cells in fighting <it>C. parapsilosis </it>and to determine the role that <it>C. parapsilosis</it>-derived lipase plays in the interaction with dendritic cells.</p> <p>Results</p> <p>Monocyte-derived immature and mature dendritic cells (iDCs and mDCs, respectively) co-cultured with live wild type or lipase deficient <it>C. parapsilosis </it>strains were studied to determine the phagocytic capacity and killing efficiency of host cells. We determined that both iDCs and mDCs efficiently phagocytosed and killed <it>C. parapsilosis</it>, furthermore our results show that the phagocytic and fungicidal activities of both iDCs and mDCs are more potent for lipase deficient compared to wild type yeast cells. In addition, the lipase deficient <it>C. parapsilosis </it>cells induce higher gene expression and protein secretion of proinflammatory cytokines and chemokines in both DC types relative to the effect of co-culture with wild type yeast cells.</p> <p>Conclusions</p> <p>Our results show that DCs are activated by exposure to <it>C. parapsilosis</it>, as shown by increased phagocytosis, killing and proinflammatory protein secretion. Moreover, these data strongly suggest that <it>C. parapsilosis </it>derived lipase has a protective role during yeast:DC interactions, since lipase production in wt yeast cells decreased the phagocytic capacity and killing efficiency of host cells and downregulated the expression of host effector molecules.</p>
topic <it>Candida</it>
dendritic cell
innate immunity
secreted lipase
url http://www.biomedcentral.com/1471-2180/11/122
work_keys_str_mv AT vagvolgyicsaba itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
AT hamarizsuzsanna itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
AT nemethtibor itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
AT filkorkata itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
AT nagyistvan itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
AT gacserattila itinvitroitinteractionsofitcandidaparapsilosisitwildtypeandlipasedeficientmutantswithhumanmonocytederiveddendriticcells
_version_ 1725494752463290368