Maize meal supply in finishing bull farms: physical and chemical variability
The work was carried out in 15 associated beef farms with the aim of monitoring animal food quantity and quality starting from the chemical analysis of the components used to formulate the total mixed rations (TMR) for finishing Charolais (CH=9 farms) and Limousin bulls (LI=4). In particular cereal...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Taylor & Francis Group
2010-04-01
|
Series: | Italian Journal of Animal Science |
Subjects: | |
Online Access: | http://www.aspajournal.it/index.php/ijas/article/view/1509 |
id |
doaj-bb278e34da19427f9321c2c69ed4e03f |
---|---|
record_format |
Article |
spelling |
doaj-bb278e34da19427f9321c2c69ed4e03f2020-11-25T01:56:34ZengTaylor & Francis GroupItalian Journal of Animal Science1594-40771828-051X2010-04-0161s36036210.4081/ijas.2007.1s.360Maize meal supply in finishing bull farms: physical and chemical variabilityM. IacurtoK. CarboneD. SettineriThe work was carried out in 15 associated beef farms with the aim of monitoring animal food quantity and quality starting from the chemical analysis of the components used to formulate the total mixed rations (TMR) for finishing Charolais (CH=9 farms) and Limousin bulls (LI=4). In particular cereal grains, mainly maize, constitute the 25.6% + 6.7 (as fed) of TMR. The samples of maize grains were collected for about three months (N=57) to perform chemical analysis: dry matter, crude protein, ether extract, ash, soluble polysaccharides (SC, by a-amylase treatment) and fibre fractions (a-NDF, ADF, ADL). The a-amylase treatment did not give values of fibrous fractions with a satisfying repeatability and there is not a good accord between SC (100- indigested residue) and calculated non fibrous carbohydrates (NFC) values; presumably because it, alone, is not able to degrade crystalline starch (slowly digestible starch). The performing of a heating pre-treatment, to gelatinize starch, improves amylase effectiveness, but it seems to remove some other analytical components, as protein and/or ash (SC =76.3 vs NFC =73.3).http://www.aspajournal.it/index.php/ijas/article/view/1509Soluble Carbohydrates, ND-Fibre Analysis. |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
M. Iacurto K. Carbone D. Settineri |
spellingShingle |
M. Iacurto K. Carbone D. Settineri Maize meal supply in finishing bull farms: physical and chemical variability Italian Journal of Animal Science Soluble Carbohydrates, ND-Fibre Analysis. |
author_facet |
M. Iacurto K. Carbone D. Settineri |
author_sort |
M. Iacurto |
title |
Maize meal supply in finishing bull farms: physical and chemical variability |
title_short |
Maize meal supply in finishing bull farms: physical and chemical variability |
title_full |
Maize meal supply in finishing bull farms: physical and chemical variability |
title_fullStr |
Maize meal supply in finishing bull farms: physical and chemical variability |
title_full_unstemmed |
Maize meal supply in finishing bull farms: physical and chemical variability |
title_sort |
maize meal supply in finishing bull farms: physical and chemical variability |
publisher |
Taylor & Francis Group |
series |
Italian Journal of Animal Science |
issn |
1594-4077 1828-051X |
publishDate |
2010-04-01 |
description |
The work was carried out in 15 associated beef farms with the aim of monitoring animal food quantity and quality starting from the chemical analysis of the components used to formulate the total mixed rations (TMR) for finishing Charolais (CH=9 farms) and Limousin bulls (LI=4). In particular cereal grains, mainly maize, constitute the 25.6% + 6.7 (as fed) of TMR. The samples of maize grains were collected for about three months (N=57) to perform chemical analysis: dry matter, crude protein, ether extract, ash, soluble polysaccharides (SC, by a-amylase treatment) and fibre fractions (a-NDF, ADF, ADL). The a-amylase treatment did not give values of fibrous fractions with a satisfying repeatability and there is not a good accord between SC (100- indigested residue) and calculated non fibrous carbohydrates (NFC) values; presumably because it, alone, is not able to degrade crystalline starch (slowly digestible starch). The performing of a heating pre-treatment, to gelatinize starch, improves amylase effectiveness, but it seems to remove some other analytical components, as protein and/or ash (SC =76.3 vs NFC =73.3). |
topic |
Soluble Carbohydrates, ND-Fibre Analysis. |
url |
http://www.aspajournal.it/index.php/ijas/article/view/1509 |
work_keys_str_mv |
AT miacurto maizemealsupplyinfinishingbullfarmsphysicalandchemicalvariability AT kcarbone maizemealsupplyinfinishingbullfarmsphysicalandchemicalvariability AT dsettineri maizemealsupplyinfinishingbullfarmsphysicalandchemicalvariability |
_version_ |
1724979183135752192 |