Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism

Bibliographic Details
Main Author:	The Staff
Format:	Article
Language:	English
Published:	Public Library of Science (PLoS) 2014-01-01
Series:	PLoS ONE
Online Access:	https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4062489/?tool=EBI

id	doaj-b7b0bd6bd68c4764978231db26c8afca
record_format	Article
spelling	doaj-b7b0bd6bd68c4764978231db26c8afca2021-03-04T13:00:53ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0196Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-MetabolismThe Staffhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4062489/?tool=EBI
collection	DOAJ
language	English
format	Article
sources	DOAJ
author	The Staff
spellingShingle	The Staff Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism PLoS ONE
author_facet	The Staff
author_sort	The Staff
title	Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
title_short	Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
title_full	Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
title_fullStr	Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
title_full_unstemmed	Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
title_sort	correction: phex mimetic (spr4-peptide) corrects and improves hyp and wild type mice energy-metabolism
publisher	Public Library of Science (PLoS)
series	PLoS ONE
issn	1932-6203
publishDate	2014-01-01
url	https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4062489/?tool=EBI
work_keys_str_mv	AT thestaff correctionphexmimeticspr4peptidecorrectsandimproveshypandwildtypemiceenergymetabolism
_version_	1714800883951206400

Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism

Similar Items