The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish
<p>Abstract</p> <p>Background</p> <p>Death receptors on the cell surface and the interacting cytosolic molecules, adaptors and initiator caspases, are essential as core components of the extrinsic apoptotic signaling pathway. While the apoptotic machinery governing the...
Main Authors: | , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
BMC
2007-06-01
|
Series: | BMC Genomics |
Online Access: | http://www.biomedcentral.com/1471-2164/8/141 |
id |
doaj-b4171a21adf74e6789b5d59fcae38545 |
---|---|
record_format |
Article |
spelling |
doaj-b4171a21adf74e6789b5d59fcae385452020-11-25T02:27:43ZengBMCBMC Genomics1471-21642007-06-018114110.1186/1471-2164-8-141The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fishKominami KatsuyaNozaki MasamiSakamaki KazuhiroSatou Yutaka<p>Abstract</p> <p>Background</p> <p>Death receptors on the cell surface and the interacting cytosolic molecules, adaptors and initiator caspases, are essential as core components of the extrinsic apoptotic signaling pathway. While the apoptotic machinery governing the extrinsic signaling pathway is well characterized in mammals, it is not fully understood in fish.</p> <p>Results</p> <p>We identified and characterized orthologs of mammalian Fas, FADD and caspase-8 that correspond to the death receptor, adaptor and initiator caspase, from the Medaka fish (<it>Oryzias latipes</it>). Medaka Fas, caspase-8 and FADD exhibited protein structures similar to that of their mammalian counterparts, containing a death domain (DD), a death effector domain (DED) or both. Functional analyses indicated that these molecules possess killing activity in mammalian cell lines upon overexpression or following activation by apoptotic stimuli, suggesting similar pro-apoptotic functions in the extrinsic pathway as those in mammals. Genomic sequence analysis revealed that the Medaka <it>fas </it>(<it>tnfrsf6</it>), <it>fadd </it>and <it>caspase-8 </it>(<it>casp8</it>) genes are organized in a similar genomic structure as the mammalian genes. Database search and phylogenetic analysis revealed that the <it>fas </it>gene, but not the <it>fadd </it>and <it>casp8 </it>genes, appear to be present only in vertebrates.</p> <p>Conclusion</p> <p>Our results indicate that the core components necessary for the extrinsic apoptotic pathway are evolutionarily conserved in function and structure across vertebrate species. Based on these results, we presume the mechanism of apoptosis induction via death receptors was evolutionarily established during the appearance of vertebrates.</p> http://www.biomedcentral.com/1471-2164/8/141 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Kominami Katsuya Nozaki Masami Sakamaki Kazuhiro Satou Yutaka |
spellingShingle |
Kominami Katsuya Nozaki Masami Sakamaki Kazuhiro Satou Yutaka The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish BMC Genomics |
author_facet |
Kominami Katsuya Nozaki Masami Sakamaki Kazuhiro Satou Yutaka |
author_sort |
Kominami Katsuya |
title |
The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish |
title_short |
The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish |
title_full |
The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish |
title_fullStr |
The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish |
title_full_unstemmed |
The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish |
title_sort |
evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in medaka fish |
publisher |
BMC |
series |
BMC Genomics |
issn |
1471-2164 |
publishDate |
2007-06-01 |
description |
<p>Abstract</p> <p>Background</p> <p>Death receptors on the cell surface and the interacting cytosolic molecules, adaptors and initiator caspases, are essential as core components of the extrinsic apoptotic signaling pathway. While the apoptotic machinery governing the extrinsic signaling pathway is well characterized in mammals, it is not fully understood in fish.</p> <p>Results</p> <p>We identified and characterized orthologs of mammalian Fas, FADD and caspase-8 that correspond to the death receptor, adaptor and initiator caspase, from the Medaka fish (<it>Oryzias latipes</it>). Medaka Fas, caspase-8 and FADD exhibited protein structures similar to that of their mammalian counterparts, containing a death domain (DD), a death effector domain (DED) or both. Functional analyses indicated that these molecules possess killing activity in mammalian cell lines upon overexpression or following activation by apoptotic stimuli, suggesting similar pro-apoptotic functions in the extrinsic pathway as those in mammals. Genomic sequence analysis revealed that the Medaka <it>fas </it>(<it>tnfrsf6</it>), <it>fadd </it>and <it>caspase-8 </it>(<it>casp8</it>) genes are organized in a similar genomic structure as the mammalian genes. Database search and phylogenetic analysis revealed that the <it>fas </it>gene, but not the <it>fadd </it>and <it>casp8 </it>genes, appear to be present only in vertebrates.</p> <p>Conclusion</p> <p>Our results indicate that the core components necessary for the extrinsic apoptotic pathway are evolutionarily conserved in function and structure across vertebrate species. Based on these results, we presume the mechanism of apoptosis induction via death receptors was evolutionarily established during the appearance of vertebrates.</p> |
url |
http://www.biomedcentral.com/1471-2164/8/141 |
work_keys_str_mv |
AT kominamikatsuya theevolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT nozakimasami theevolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT sakamakikazuhiro theevolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT satouyutaka theevolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT kominamikatsuya evolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT nozakimasami evolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT sakamakikazuhiro evolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish AT satouyutaka evolutionaryconservationofthecorecomponentsnecessaryfortheextrinsicapoptoticsignalingpathwayinmedakafish |
_version_ |
1724841220074635264 |