Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells

Background: Muscle-derived satellite cells (MDSCs) express MHC molecules intimately related to muscle function, which is supposed to be affected by local estrogen (E2) levels. However, cellular targets and molecular mechanisms involved are poorly understood. Methods: Genioglossus (GG) muscle tissues...

Full description

Bibliographic Details
Main Authors: Tao Guo, Wenjia Liu, Anna Konermann, Zexu Gu, Meng Cao, Yin Ding
Format: Article
Language:English
Published: Cell Physiol Biochem Press GmbH & Co KG 2014-03-01
Series:Cellular Physiology and Biochemistry
Subjects:
Online Access:http://www.karger.com/Article/FullText/358644
id doaj-acd9a0c4899a4837969863101c90e666
record_format Article
spelling doaj-acd9a0c4899a4837969863101c90e6662020-11-24T21:50:24ZengCell Physiol Biochem Press GmbH & Co KGCellular Physiology and Biochemistry1015-89871421-97782014-03-0133368169110.1159/000358644358644Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite CellsTao GuoWenjia LiuAnna KonermannZexu GuMeng CaoYin DingBackground: Muscle-derived satellite cells (MDSCs) express MHC molecules intimately related to muscle function, which is supposed to be affected by local estrogen (E2) levels. However, cellular targets and molecular mechanisms involved are poorly understood. Methods: Genioglossus (GG) muscle tissues and MDSCs were derived from SHAM, ovariectomized or ovariectomized and 17 β-estradiol injected rats (n=10 ⁄ group). ERα, ERβ, MHC expression and underlying regulatory mechanisms were investigated by RT-PCR, western blot and immunohistochemistry, inter alia upon selective antagonist exposure and Si-RNA transfection. MDSC viability and cell cycle were examined by MTT and flow cytometry. Results: E2 upregulated MHC-I and downregulated MHC-IIb expression in MDSCs. E2 mediated effects on these molecules were inhibited by ERα-selective antagonist MPP and si-ERα, whereas they persisted upon exposure to ERβ-selective antagonist PHTPP. ERα was significantly higher expressed in muscle tissues compared to ERβ. ER positive stainings were fewer in the ovariectomized than in the SHAM group. Injection of E2 only increased the positive staining of ERα, but not of ERβ. Conclusion: Results suggest that E2 regulates MHC expression mainly through an ERα-mediated pathway with opposing effects on MHC-I and MHC-IIb. Thus, different hormonal processes that impact muscular pathophysiology presumably govern the functional properties of these molecules.http://www.karger.com/Article/FullText/358644Estrogen receptorEstrogen receptor selective antagonistMyosin heavy chainMuscle-derived satellite cells
collection DOAJ
language English
format Article
sources DOAJ
author Tao Guo
Wenjia Liu
Anna Konermann
Zexu Gu
Meng Cao
Yin Ding
spellingShingle Tao Guo
Wenjia Liu
Anna Konermann
Zexu Gu
Meng Cao
Yin Ding
Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
Cellular Physiology and Biochemistry
Estrogen receptor
Estrogen receptor selective antagonist
Myosin heavy chain
Muscle-derived satellite cells
author_facet Tao Guo
Wenjia Liu
Anna Konermann
Zexu Gu
Meng Cao
Yin Ding
author_sort Tao Guo
title Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
title_short Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
title_full Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
title_fullStr Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
title_full_unstemmed Estradiol Modulates the Expression Pattern of Myosin Heavy Chain Subtypes via an ERα-Mediated Pathway in Muscle-Derived Tissues and Satellite Cells
title_sort estradiol modulates the expression pattern of myosin heavy chain subtypes via an erα-mediated pathway in muscle-derived tissues and satellite cells
publisher Cell Physiol Biochem Press GmbH & Co KG
series Cellular Physiology and Biochemistry
issn 1015-8987
1421-9778
publishDate 2014-03-01
description Background: Muscle-derived satellite cells (MDSCs) express MHC molecules intimately related to muscle function, which is supposed to be affected by local estrogen (E2) levels. However, cellular targets and molecular mechanisms involved are poorly understood. Methods: Genioglossus (GG) muscle tissues and MDSCs were derived from SHAM, ovariectomized or ovariectomized and 17 β-estradiol injected rats (n=10 ⁄ group). ERα, ERβ, MHC expression and underlying regulatory mechanisms were investigated by RT-PCR, western blot and immunohistochemistry, inter alia upon selective antagonist exposure and Si-RNA transfection. MDSC viability and cell cycle were examined by MTT and flow cytometry. Results: E2 upregulated MHC-I and downregulated MHC-IIb expression in MDSCs. E2 mediated effects on these molecules were inhibited by ERα-selective antagonist MPP and si-ERα, whereas they persisted upon exposure to ERβ-selective antagonist PHTPP. ERα was significantly higher expressed in muscle tissues compared to ERβ. ER positive stainings were fewer in the ovariectomized than in the SHAM group. Injection of E2 only increased the positive staining of ERα, but not of ERβ. Conclusion: Results suggest that E2 regulates MHC expression mainly through an ERα-mediated pathway with opposing effects on MHC-I and MHC-IIb. Thus, different hormonal processes that impact muscular pathophysiology presumably govern the functional properties of these molecules.
topic Estrogen receptor
Estrogen receptor selective antagonist
Myosin heavy chain
Muscle-derived satellite cells
url http://www.karger.com/Article/FullText/358644
work_keys_str_mv AT taoguo estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
AT wenjialiu estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
AT annakonermann estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
AT zexugu estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
AT mengcao estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
AT yinding estradiolmodulatestheexpressionpatternofmyosinheavychainsubtypesviaaneramediatedpathwayinmusclederivedtissuesandsatellitecells
_version_ 1725884317743185920