Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli

Purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli L3 larvae stage ABSTRACT. The main immunoglobulin fraction of poultry is called IgY, in order to distinguish it from the mammalian IgG. This article focus on purification yolk immunoglobulin of hens vacc...

Full description

Bibliographic Details
Main Authors: Darmawi Darmawi, Ummu Balqis, Risa Tiuria, Muhammad Hambal, Samadi Samadi
Format: Article
Language:English
Published: Syiah Kuala University 2010-10-01
Series:Jurnal Agripet
Subjects:
Online Access:http://jurnal.unsyiah.ac.id/agripet/article/view/638
id doaj-aac67c3c12cb4e998c8c6b92f726b30b
record_format Article
spelling doaj-aac67c3c12cb4e998c8c6b92f726b30b2020-11-24T22:35:07ZengSyiah Kuala UniversityJurnal Agripet1411-46232460-45342010-10-0110291510.17969/agripet.v10i2.638628Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galliDarmawi Darmawi0Ummu Balqis1Risa Tiuria2Muhammad Hambal3Samadi Samadi4Fakultas Kedokteran Hewan, Universitas Syiah KualaFakultas Kedokteran Hewan, Universitas Syiah KualaFakultas Kedokteran Hewan, Institut Pertanian BogorFakultas Kedokteran Hewan, Universitas Syiah KualaJurusan Peternakan, Fakultas Pertanian, Universitas Syiah KualaPurification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli L3 larvae stage ABSTRACT. The main immunoglobulin fraction of poultry is called IgY, in order to distinguish it from the mammalian IgG. This article focus on purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli larvae to obtained purity IgY. Active vaccinations with excretory/secretory antigen were applied intra muscularly of chickens with an initial dose of 80 μg. The vaccinations were repeated three times with dose of each 60 μg with an interval of one week. The first vaccinations were excretory/secretory antigen mixed with Fruend Adjuvant Complete and subsequently mixed with Freund Adjuvant Incomplete. Antibody response in yolk was detected at weekly intervals by agar gel precipitation test (AGPT). The chicken’s eggs were collected from 49 day after vaccinations. IgY was extracted from egg yolks by means of ammonium sulphate and purified using fast performance liquid chromatography (FPLC). The purity of anti-ekscretory/secretory IgY protein was determined by Bradford method (λ = 280 nm). The result showed that antibody in yolk was begun detect with AGPT at four weeks after vaccination. IgY concentration after purification was 0,875 ± 0.251 mg/ml. This study has shown that the product released in vitro by L3 stage A. galli is capable of stimulating humoral immunity by mean of producing antibody through yolk as biologic manufacturer could be a good choice.http://jurnal.unsyiah.ac.id/agripet/article/view/638ascaridia galliexcretorysecretory antigenyolk Immunoglobulin
collection DOAJ
language English
format Article
sources DOAJ
author Darmawi Darmawi
Ummu Balqis
Risa Tiuria
Muhammad Hambal
Samadi Samadi
spellingShingle Darmawi Darmawi
Ummu Balqis
Risa Tiuria
Muhammad Hambal
Samadi Samadi
Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
Jurnal Agripet
ascaridia galli
excretory
secretory antigen
yolk Immunoglobulin
author_facet Darmawi Darmawi
Ummu Balqis
Risa Tiuria
Muhammad Hambal
Samadi Samadi
author_sort Darmawi Darmawi
title Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
title_short Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
title_full Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
title_fullStr Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
title_full_unstemmed Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli
title_sort purifikasi imunoglobulin yolk pada ayam yang divaksin terhadap ekskretori/sekretori stadium l3 ascaridia galli
publisher Syiah Kuala University
series Jurnal Agripet
issn 1411-4623
2460-4534
publishDate 2010-10-01
description Purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli L3 larvae stage ABSTRACT. The main immunoglobulin fraction of poultry is called IgY, in order to distinguish it from the mammalian IgG. This article focus on purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli larvae to obtained purity IgY. Active vaccinations with excretory/secretory antigen were applied intra muscularly of chickens with an initial dose of 80 μg. The vaccinations were repeated three times with dose of each 60 μg with an interval of one week. The first vaccinations were excretory/secretory antigen mixed with Fruend Adjuvant Complete and subsequently mixed with Freund Adjuvant Incomplete. Antibody response in yolk was detected at weekly intervals by agar gel precipitation test (AGPT). The chicken’s eggs were collected from 49 day after vaccinations. IgY was extracted from egg yolks by means of ammonium sulphate and purified using fast performance liquid chromatography (FPLC). The purity of anti-ekscretory/secretory IgY protein was determined by Bradford method (λ = 280 nm). The result showed that antibody in yolk was begun detect with AGPT at four weeks after vaccination. IgY concentration after purification was 0,875 ± 0.251 mg/ml. This study has shown that the product released in vitro by L3 stage A. galli is capable of stimulating humoral immunity by mean of producing antibody through yolk as biologic manufacturer could be a good choice.
topic ascaridia galli
excretory
secretory antigen
yolk Immunoglobulin
url http://jurnal.unsyiah.ac.id/agripet/article/view/638
work_keys_str_mv AT darmawidarmawi purifikasiimunoglobulinyolkpadaayamyangdivaksinterhadapekskretorisekretoristadiuml3ascaridiagalli
AT ummubalqis purifikasiimunoglobulinyolkpadaayamyangdivaksinterhadapekskretorisekretoristadiuml3ascaridiagalli
AT risatiuria purifikasiimunoglobulinyolkpadaayamyangdivaksinterhadapekskretorisekretoristadiuml3ascaridiagalli
AT muhammadhambal purifikasiimunoglobulinyolkpadaayamyangdivaksinterhadapekskretorisekretoristadiuml3ascaridiagalli
AT samadisamadi purifikasiimunoglobulinyolkpadaayamyangdivaksinterhadapekskretorisekretoristadiuml3ascaridiagalli
_version_ 1725724773158223872