Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets
This study investigated the effects of weaning on the hepatic redox status, apoptosis, function, and the mitogen-activated protein kinase (MAPK) signaling pathways during the first week after weaning in piglets. A total of 12 litters of piglets were weaned at d 21 and divided into the weaning group...
Main Authors: | , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Hindawi Limited
2016-01-01
|
Series: | Oxidative Medicine and Cellular Longevity |
Online Access: | http://dx.doi.org/10.1155/2016/4768541 |
id |
doaj-a8ab909865334bd3a4562f9fab2f73fb |
---|---|
record_format |
Article |
spelling |
doaj-a8ab909865334bd3a4562f9fab2f73fb2020-11-24T22:20:44ZengHindawi LimitedOxidative Medicine and Cellular Longevity1942-09001942-09942016-01-01201610.1155/2016/47685414768541Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in PigletsZhen Luo0Wei Zhu1Qi Guo2Wenli Luo3Jing Zhang4Weina Xu5Jianxiong Xu6School of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaSchool of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai Key Laboratory of Veterinary Biotechnology, Shanghai 200240, ChinaThis study investigated the effects of weaning on the hepatic redox status, apoptosis, function, and the mitogen-activated protein kinase (MAPK) signaling pathways during the first week after weaning in piglets. A total of 12 litters of piglets were weaned at d 21 and divided into the weaning group (WG) and the control group (CG). Six piglets from each group were slaughtered at d 0 (d 20, referred to weaning), d 1, d 4, and d 7 after weaning. Results showed that weaning significantly increased the concentrations of hepatic free radicals H2O2 and NO, malondialdehyde (MDA), and 8-hydroxy-2′-deoxyguanosine (8-OHdG), while significantly decreasing the inhibitory hydroxyl ability (IHA) and glutathione peroxidase (GSH-Px), and altered the level of superoxide dismutase (SOD). The apoptosis results showed that weaning increased the concentrations of caspase-3, caspase-8, caspase-9 and the ratio of Bax/Bcl-2. In addition, aspartate aminotransferase transaminase (AST) and alanine aminotransferase (ALT) in liver homogenates increased after weaning. The phosphorylated JNK and ERK1/2 increased, while the activated p38 initially decreased and then increased. Our results suggested that weaning increased the hepatic oxidative stress and aminotransferases and initiated apoptosis, which may be related to the activated MAPK pathways in postweaning piglets.http://dx.doi.org/10.1155/2016/4768541 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Zhen Luo Wei Zhu Qi Guo Wenli Luo Jing Zhang Weina Xu Jianxiong Xu |
spellingShingle |
Zhen Luo Wei Zhu Qi Guo Wenli Luo Jing Zhang Weina Xu Jianxiong Xu Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets Oxidative Medicine and Cellular Longevity |
author_facet |
Zhen Luo Wei Zhu Qi Guo Wenli Luo Jing Zhang Weina Xu Jianxiong Xu |
author_sort |
Zhen Luo |
title |
Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets |
title_short |
Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets |
title_full |
Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets |
title_fullStr |
Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets |
title_full_unstemmed |
Weaning Induced Hepatic Oxidative Stress, Apoptosis, and Aminotransferases through MAPK Signaling Pathways in Piglets |
title_sort |
weaning induced hepatic oxidative stress, apoptosis, and aminotransferases through mapk signaling pathways in piglets |
publisher |
Hindawi Limited |
series |
Oxidative Medicine and Cellular Longevity |
issn |
1942-0900 1942-0994 |
publishDate |
2016-01-01 |
description |
This study investigated the effects of weaning on the hepatic redox status, apoptosis, function, and the mitogen-activated protein kinase (MAPK) signaling pathways during the first week after weaning in piglets. A total of 12 litters of piglets were weaned at d 21 and divided into the weaning group (WG) and the control group (CG). Six piglets from each group were slaughtered at d 0 (d 20, referred to weaning), d 1, d 4, and d 7 after weaning. Results showed that weaning significantly increased the concentrations of hepatic free radicals H2O2 and NO, malondialdehyde (MDA), and 8-hydroxy-2′-deoxyguanosine (8-OHdG), while significantly decreasing the inhibitory hydroxyl ability (IHA) and glutathione peroxidase (GSH-Px), and altered the level of superoxide dismutase (SOD). The apoptosis results showed that weaning increased the concentrations of caspase-3, caspase-8, caspase-9 and the ratio of Bax/Bcl-2. In addition, aspartate aminotransferase transaminase (AST) and alanine aminotransferase (ALT) in liver homogenates increased after weaning. The phosphorylated JNK and ERK1/2 increased, while the activated p38 initially decreased and then increased. Our results suggested that weaning increased the hepatic oxidative stress and aminotransferases and initiated apoptosis, which may be related to the activated MAPK pathways in postweaning piglets. |
url |
http://dx.doi.org/10.1155/2016/4768541 |
work_keys_str_mv |
AT zhenluo weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT weizhu weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT qiguo weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT wenliluo weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT jingzhang weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT weinaxu weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets AT jianxiongxu weaninginducedhepaticoxidativestressapoptosisandaminotransferasesthroughmapksignalingpathwaysinpiglets |
_version_ |
1725774291079790592 |