Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2018-10-01
|
Series: | Frontiers in Immunology |
Subjects: | |
Online Access: | https://www.frontiersin.org/article/10.3389/fimmu.2018.02197/full |
id |
doaj-a1102431c922459cbf2883fb6b1ee772 |
---|---|
record_format |
Article |
spelling |
doaj-a1102431c922459cbf2883fb6b1ee7722020-11-25T00:33:29ZengFrontiers Media S.A.Frontiers in Immunology1664-32242018-10-01910.3389/fimmu.2018.02197419299Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?Sujal Ghosh0Ingo Drexler1Sanil Bhatia2Heiko Adler3Heiko Adler4Heiko Adler5Andrew R. Gennery6Arndt Borkhardt7Department of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyInstitute for Virology, Medical Faculty, Heinrich-Heine-Universität Düsseldorf, Düsseldorf, GermanyDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyResearch Unit Lung Repair and Regeneration, Comprehensive Pneumology Center, Helmholtz Zentrum München—Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH), Munich, GermanyUniversity Hospital Grosshadern, Ludwig-Maximilians-Universität München, Munich, GermanyGerman Center for Lung Research (DZL), Giessen, GermanyPaediatric Immunology and HSCT, Newcastle University and Great North Children's Hospital, Newcastle upon Tyne, United KingdomDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, Germanyhttps://www.frontiersin.org/article/10.3389/fimmu.2018.02197/fullEpstein–Barr virus-related malignanciescombined immunodeficiencyInterleukin-2-inducible T-cell kinaselymphoproliferative disordersprimary immunodeficiency |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt |
spellingShingle |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? Frontiers in Immunology Epstein–Barr virus-related malignancies combined immunodeficiency Interleukin-2-inducible T-cell kinase lymphoproliferative disorders primary immunodeficiency |
author_facet |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt |
author_sort |
Sujal Ghosh |
title |
Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_short |
Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full |
Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_fullStr |
Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full_unstemmed |
Corrigendum: Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_sort |
corrigendum: interleukin-2-inducible t-cell kinase deficiency—new patients, new insight? |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Immunology |
issn |
1664-3224 |
publishDate |
2018-10-01 |
topic |
Epstein–Barr virus-related malignancies combined immunodeficiency Interleukin-2-inducible T-cell kinase lymphoproliferative disorders primary immunodeficiency |
url |
https://www.frontiersin.org/article/10.3389/fimmu.2018.02197/full |
work_keys_str_mv |
AT sujalghosh corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT ingodrexler corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT sanilbhatia corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT andrewrgennery corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT arndtborkhardt corrigenduminterleukin2inducibletcellkinasedeficiencynewpatientsnewinsight |
_version_ |
1725316433004462080 |