Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.

Twenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree o...

Full description

Bibliographic Details
Main Authors: Weixia Wang, Kailong Li, Pinjun Wan, Fengxiang Lai, Qiang Fu, Tingheng Zhu
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2017-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC5328259?pdf=render
id doaj-9ea75ce6d2164ca795d18fad1677d5a7
record_format Article
spelling doaj-9ea75ce6d2164ca795d18fad1677d5a72020-11-25T02:47:26ZengPublic Library of Science (PLoS)PLoS ONE1932-62032017-01-01122e017270110.1371/journal.pone.0172701Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.Weixia WangKailong LiPinjun WanFengxiang LaiQiang FuTingheng ZhuTwenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree of sequence conservation with orthologues from insects. RT-qPCR analysis revealed NlRSGs expressed at all life stages and the highest expression was observed in hemolymph, gut or wing for most of NlRSGs. RNAi demonstrated that eighteen NlRSGs play a crucial role in nymphal development. Nymphs with silenced NlRSGs failed to molt, eclosion or development arrest. The qRT-PCR analysis verified the correlation between mortality and the down-regulation of the target genes. The expression level of nuclear receptors, Kr-h1, Hr3, FTZ-F1 and E93 involved in 20E and JH signal pathway was impacted in nymphs with silenced twelve NlRSGs individually. The expression of two halloween genes, Cyp314a1 and Cyp315a1 involved in ecdysone synthesis, decreased in nymphs with silenced NlSar1 or NlArf1. Cyp307a1 increased in nymphs with silenced NlArf6. In N.lugens with silenced NlSRβ, NlSar1 and NlRab2 at 9th day individually, 0.0% eclosion rate and almost 100.0% mortality was demonstrated. Further analysis showed NlSRβ could be served as a candidate target for dsRNA-based pesticides for N.lugens control.http://europepmc.org/articles/PMC5328259?pdf=render
collection DOAJ
language English
format Article
sources DOAJ
author Weixia Wang
Kailong Li
Pinjun Wan
Fengxiang Lai
Qiang Fu
Tingheng Zhu
spellingShingle Weixia Wang
Kailong Li
Pinjun Wan
Fengxiang Lai
Qiang Fu
Tingheng Zhu
Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
PLoS ONE
author_facet Weixia Wang
Kailong Li
Pinjun Wan
Fengxiang Lai
Qiang Fu
Tingheng Zhu
author_sort Weixia Wang
title Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
title_short Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
title_full Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
title_fullStr Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
title_full_unstemmed Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development.
title_sort ras-like family small gtpases genes in nilaparvata lugens: identification, phylogenetic analysis, gene expression and function in nymphal development.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2017-01-01
description Twenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree of sequence conservation with orthologues from insects. RT-qPCR analysis revealed NlRSGs expressed at all life stages and the highest expression was observed in hemolymph, gut or wing for most of NlRSGs. RNAi demonstrated that eighteen NlRSGs play a crucial role in nymphal development. Nymphs with silenced NlRSGs failed to molt, eclosion or development arrest. The qRT-PCR analysis verified the correlation between mortality and the down-regulation of the target genes. The expression level of nuclear receptors, Kr-h1, Hr3, FTZ-F1 and E93 involved in 20E and JH signal pathway was impacted in nymphs with silenced twelve NlRSGs individually. The expression of two halloween genes, Cyp314a1 and Cyp315a1 involved in ecdysone synthesis, decreased in nymphs with silenced NlSar1 or NlArf1. Cyp307a1 increased in nymphs with silenced NlArf6. In N.lugens with silenced NlSRβ, NlSar1 and NlRab2 at 9th day individually, 0.0% eclosion rate and almost 100.0% mortality was demonstrated. Further analysis showed NlSRβ could be served as a candidate target for dsRNA-based pesticides for N.lugens control.
url http://europepmc.org/articles/PMC5328259?pdf=render
work_keys_str_mv AT weixiawang raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
AT kailongli raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
AT pinjunwan raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
AT fengxianglai raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
AT qiangfu raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
AT tinghengzhu raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment
_version_ 1724753486933917696