Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize
Antimicrobial peptides (AMPs) are small defense proteins present in various organisms. Major groups of AMPs include beta-barrelin, hevein, knottin, lipid transfer protein (LTP), thionin, defensin, snakin, and cyclotide. Most plant AMPs involve host plant resistance to pathogens such as fungi, viruse...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2017-09-01
|
Series: | International Journal of Molecular Sciences |
Subjects: | |
Online Access: | https://www.mdpi.com/1422-0067/18/9/1938 |
id |
doaj-99e19e523e05478aa6c7aa73ec3189ee |
---|---|
record_format |
Article |
spelling |
doaj-99e19e523e05478aa6c7aa73ec3189ee2020-11-25T00:09:36ZengMDPI AGInternational Journal of Molecular Sciences1422-00672017-09-01189193810.3390/ijms18091938ijms18091938Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in MaizeJoseph Noonan0William Paul Williams1Xueyan Shan2Department of Biochemistry, Molecular Biology, Entomology and Plant Pathology, Mississippi State University, Mississippi State, MS 39762, USAUSDA-ARS, Corn Host Plant Resistance Research Unit, Mississippi State, MS 39762, USADepartment of Biochemistry, Molecular Biology, Entomology and Plant Pathology, Mississippi State University, Mississippi State, MS 39762, USAAntimicrobial peptides (AMPs) are small defense proteins present in various organisms. Major groups of AMPs include beta-barrelin, hevein, knottin, lipid transfer protein (LTP), thionin, defensin, snakin, and cyclotide. Most plant AMPs involve host plant resistance to pathogens such as fungi, viruses, and bacteria, whereas a few plant AMPs from the cyclotide family carry insecticidal functions. In this research, a genome-wide investigation on antimicrobial peptide genes in maize genome was conducted. AMPs previously identified from various plant species were used as query sequences for maize genome data mining. Thirty-nine new maize AMPs were identified in addition to seven known maize AMPs. Protein sequence analysis revealed 10 distinguishable maize AMP groups. Analysis of mRNA expression of maize AMP genes by quantitative real-time polymerase chain reaction (qRT-PCR) revealed different expression patterns in a panel of 10 maize inbred lines. Five maize AMP genes were found significantly associated with insect or fungus resistance. Identification of maize antimicrobial peptide genes will facilitate the breeding of host plant resistance and improve maize production.https://www.mdpi.com/1422-0067/18/9/1938plant antimicrobial peptidesdefensinheveinsnakincyclotidemaizehost plant resistance |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Joseph Noonan William Paul Williams Xueyan Shan |
spellingShingle |
Joseph Noonan William Paul Williams Xueyan Shan Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize International Journal of Molecular Sciences plant antimicrobial peptides defensin hevein snakin cyclotide maize host plant resistance |
author_facet |
Joseph Noonan William Paul Williams Xueyan Shan |
author_sort |
Joseph Noonan |
title |
Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize |
title_short |
Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize |
title_full |
Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize |
title_fullStr |
Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize |
title_full_unstemmed |
Investigation of Antimicrobial Peptide Genes Associated with Fungus and Insect Resistance in Maize |
title_sort |
investigation of antimicrobial peptide genes associated with fungus and insect resistance in maize |
publisher |
MDPI AG |
series |
International Journal of Molecular Sciences |
issn |
1422-0067 |
publishDate |
2017-09-01 |
description |
Antimicrobial peptides (AMPs) are small defense proteins present in various organisms. Major groups of AMPs include beta-barrelin, hevein, knottin, lipid transfer protein (LTP), thionin, defensin, snakin, and cyclotide. Most plant AMPs involve host plant resistance to pathogens such as fungi, viruses, and bacteria, whereas a few plant AMPs from the cyclotide family carry insecticidal functions. In this research, a genome-wide investigation on antimicrobial peptide genes in maize genome was conducted. AMPs previously identified from various plant species were used as query sequences for maize genome data mining. Thirty-nine new maize AMPs were identified in addition to seven known maize AMPs. Protein sequence analysis revealed 10 distinguishable maize AMP groups. Analysis of mRNA expression of maize AMP genes by quantitative real-time polymerase chain reaction (qRT-PCR) revealed different expression patterns in a panel of 10 maize inbred lines. Five maize AMP genes were found significantly associated with insect or fungus resistance. Identification of maize antimicrobial peptide genes will facilitate the breeding of host plant resistance and improve maize production. |
topic |
plant antimicrobial peptides defensin hevein snakin cyclotide maize host plant resistance |
url |
https://www.mdpi.com/1422-0067/18/9/1938 |
work_keys_str_mv |
AT josephnoonan investigationofantimicrobialpeptidegenesassociatedwithfungusandinsectresistanceinmaize AT williampaulwilliams investigationofantimicrobialpeptidegenesassociatedwithfungusandinsectresistanceinmaize AT xueyanshan investigationofantimicrobialpeptidegenesassociatedwithfungusandinsectresistanceinmaize |
_version_ |
1725410872657969152 |