Fitat dan fitase : dampak pada hewan ternak
In countries with high plant biodiversity such as Indonesia, the availability of food of plant origin is very diverse. The presence of anti-nutrients in plants would potentially cause problems in cattle if not managed properly. phytic acid is one anti nutritional factor that have a role in disrupti...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Fakultas Peternakan Universitas Brawijaya
2017-03-01
|
| Series: | Jurnal Ilmu-Ilmu Peternakan |
| Online Access: | http://jiip.ub.ac.id/index.php/jiip/article/view/258 |
| id |
doaj-972e00af948640d095d6f1232a7940ec |
|---|---|
| record_format |
Article |
| spelling |
doaj-972e00af948640d095d6f1232a7940ec2020-11-25T01:15:45ZengFakultas Peternakan Universitas BrawijayaJurnal Ilmu-Ilmu Peternakan0852-36812443-07652017-03-01263597810.21776/ub.jiip.2016.026.03.09245Fitat dan fitase : dampak pada hewan ternakYanuartono Yanuartono0Alfarisa Nururrozi1Soedarmanto Indarjulianto2Fakultas Kedokteran Hewan Universitas Gadjah MadaFakultas Kedokteran Hewan Universitas Gadjah MadaFakultas Kedokteran Hewan Universitas Gadjah MadaIn countries with high plant biodiversity such as Indonesia, the availability of food of plant origin is very diverse. The presence of anti-nutrients in plants would potentially cause problems in cattle if not managed properly. phytic acid is one anti nutritional factor that have a role in disrupting the health and productivity The term phytate refers to the molecule phytic acid, which generally acts as a chelate to Mg, Ca, Na, and K, and in some cases protein and carbohydrates. Seeds of cereals, legumes and oilseed plant which is used as animal feed usually contains a lot of phytic acid which can cause a decline in nutritional value. However, with a variety of processing methods, levels of phytic acid in animal feed can be reduced or even eliminated. In addition to the processing method, the method of adding phytase enzyme may also be done to improve the nutritional value of the animal feed ingredients. Keywords:anti-nutrients.phytic acid. processingmethods.phytasehttp://jiip.ub.ac.id/index.php/jiip/article/view/258 |
| collection |
DOAJ |
| language |
English |
| format |
Article |
| sources |
DOAJ |
| author |
Yanuartono Yanuartono Alfarisa Nururrozi Soedarmanto Indarjulianto |
| spellingShingle |
Yanuartono Yanuartono Alfarisa Nururrozi Soedarmanto Indarjulianto Fitat dan fitase : dampak pada hewan ternak Jurnal Ilmu-Ilmu Peternakan |
| author_facet |
Yanuartono Yanuartono Alfarisa Nururrozi Soedarmanto Indarjulianto |
| author_sort |
Yanuartono Yanuartono |
| title |
Fitat dan fitase : dampak pada hewan ternak |
| title_short |
Fitat dan fitase : dampak pada hewan ternak |
| title_full |
Fitat dan fitase : dampak pada hewan ternak |
| title_fullStr |
Fitat dan fitase : dampak pada hewan ternak |
| title_full_unstemmed |
Fitat dan fitase : dampak pada hewan ternak |
| title_sort |
fitat dan fitase : dampak pada hewan ternak |
| publisher |
Fakultas Peternakan Universitas Brawijaya |
| series |
Jurnal Ilmu-Ilmu Peternakan |
| issn |
0852-3681 2443-0765 |
| publishDate |
2017-03-01 |
| description |
In countries with high plant biodiversity such as Indonesia, the availability of food of plant origin is very diverse. The presence of anti-nutrients in plants would potentially cause problems in cattle if not managed properly. phytic acid is one anti nutritional factor that have a role in disrupting the health and productivity The term phytate refers to the molecule phytic acid, which generally acts as a chelate to Mg, Ca, Na, and K, and in some cases protein and carbohydrates. Seeds of cereals, legumes and oilseed plant which is used as animal feed usually contains a lot of phytic acid which can cause a decline in nutritional value. However, with a variety of processing methods, levels of phytic acid in animal feed can be reduced or even eliminated. In addition to the processing method, the method of adding phytase enzyme may also be done to improve the nutritional value of the animal feed ingredients.
Keywords:anti-nutrients.phytic acid. processingmethods.phytase |
| url |
http://jiip.ub.ac.id/index.php/jiip/article/view/258 |
| work_keys_str_mv |
AT yanuartonoyanuartono fitatdanfitasedampakpadahewanternak AT alfarisanururrozi fitatdanfitasedampakpadahewanternak AT soedarmantoindarjulianto fitatdanfitasedampakpadahewanternak |
| _version_ |
1725151372278497280 |