Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria

Abstract Background Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Associat...

Full description

Bibliographic Details
Main Authors: Y. R. L. Tan, C.-T. C. Chow, I. Ganesan, H. M. E. Leow
Format: Article
Language:English
Published: BMC 2021-06-01
Series:BMC Pediatrics
Subjects:
Online Access:https://doi.org/10.1186/s12887-021-02758-1
id doaj-93829695ceb340fb9113d49d00ea39e1
record_format Article
spelling doaj-93829695ceb340fb9113d49d00ea39e12021-06-20T11:16:38ZengBMCBMC Pediatrics1471-24312021-06-012111610.1186/s12887-021-02758-1Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteriaY. R. L. Tan0C.-T. C. Chow1I. Ganesan2H. M. E. Leow3Department of Paediatrics, KK Women’s and Children’s HospitalDepartment of Paediatrics, KK Women’s and Children’s HospitalDepartment of Paediatrics, KK Women’s and Children’s HospitalDepartment of Paediatrics, KK Women’s and Children’s HospitalAbstract Background Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete KD. Case presentation We report on a child who was initially treated for Escherichia coli left pyelonephritis and Influenza A and Rhinovirus / Enterovirus upper respiratory tract infection. The child developed an acute hydrocele and a maculopapular rash during the illness course, which prompted further evaluation for concomitant atypical KD, although there were no other physical signs suggestive of classic KD at the time. Subsequent diagnosis of atypical KD was made with confirmation on echocardiography, with timely administration of intravenous immunoglobulin. Conclusions Although there are well recognized clinical features associated with classic Kawasaki Disease, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete Kawasaki Disease. This case report highlights the importance of considering a diagnosis of KD in a child with prolonged fever and unexplainable symptoms suggestive of inflammation, in this case, the rare presentation of an acute hydrocele. We recommend that for any child with prolonged unexplained fever, Kawasaki Disease should be considered. Trial registration Not applicable.https://doi.org/10.1186/s12887-021-02758-1Case reportKawasaki diseaseAtypicalDiagnostic criteriaHydrocele
collection DOAJ
language English
format Article
sources DOAJ
author Y. R. L. Tan
C.-T. C. Chow
I. Ganesan
H. M. E. Leow
spellingShingle Y. R. L. Tan
C.-T. C. Chow
I. Ganesan
H. M. E. Leow
Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
BMC Pediatrics
Case report
Kawasaki disease
Atypical
Diagnostic criteria
Hydrocele
author_facet Y. R. L. Tan
C.-T. C. Chow
I. Ganesan
H. M. E. Leow
author_sort Y. R. L. Tan
title Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
title_short Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
title_full Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
title_fullStr Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
title_full_unstemmed Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
title_sort hydrocele in a case of atypical kawasaki disease: case report and review of diagnostic criteria
publisher BMC
series BMC Pediatrics
issn 1471-2431
publishDate 2021-06-01
description Abstract Background Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete KD. Case presentation We report on a child who was initially treated for Escherichia coli left pyelonephritis and Influenza A and Rhinovirus / Enterovirus upper respiratory tract infection. The child developed an acute hydrocele and a maculopapular rash during the illness course, which prompted further evaluation for concomitant atypical KD, although there were no other physical signs suggestive of classic KD at the time. Subsequent diagnosis of atypical KD was made with confirmation on echocardiography, with timely administration of intravenous immunoglobulin. Conclusions Although there are well recognized clinical features associated with classic Kawasaki Disease, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete Kawasaki Disease. This case report highlights the importance of considering a diagnosis of KD in a child with prolonged fever and unexplainable symptoms suggestive of inflammation, in this case, the rare presentation of an acute hydrocele. We recommend that for any child with prolonged unexplained fever, Kawasaki Disease should be considered. Trial registration Not applicable.
topic Case report
Kawasaki disease
Atypical
Diagnostic criteria
Hydrocele
url https://doi.org/10.1186/s12887-021-02758-1
work_keys_str_mv AT yrltan hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria
AT ctcchow hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria
AT iganesan hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria
AT hmeleow hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria
_version_ 1721370242363424768