Effect of defoliation on production components at different growth stages of cowpea

ABSTRACT Cowpea (Vigna unguiculata (L.) Walp.) is an important crop for food and the main source of plant protein for tropical and subtropical regions of the world. The objective of this study was to verify the influence of defoliation levels in three stages of development of cowpea plants cv. '...

Full description

Bibliographic Details
Main Authors: Oscar José Smiderle, Hyanameyka Evangelista de Lima-Primo, Haroldo Duarte Barbosa, Aline das Graças Souza
Format: Article
Language:English
Published: Universidade Federal do Ceará
Series:Revista Ciência Agronômica
Subjects:
Online Access:http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1806-66902017000500840&lng=en&tlng=en
id doaj-8ff2b6d217ba43559b4da809c7542711
record_format Article
spelling doaj-8ff2b6d217ba43559b4da809c75427112020-11-25T01:48:48ZengUniversidade Federal do CearáRevista Ciência Agronômica 1806-6690485spe84084710.5935/1806-6690.20170099S1806-66902017000500840Effect of defoliation on production components at different growth stages of cowpeaOscar José SmiderleHyanameyka Evangelista de Lima-PrimoHaroldo Duarte BarbosaAline das Graças SouzaABSTRACT Cowpea (Vigna unguiculata (L.) Walp.) is an important crop for food and the main source of plant protein for tropical and subtropical regions of the world. The objective of this study was to verify the influence of defoliation levels in three stages of development of cowpea plants cv. 'BRS Bragança' on production components. The experiment was carried out at Embrapa Roraima in a greenhouse adopting the completely randomized design with five replications arranged in a factorial scheme 3 x 3. Three phenological stages (trifoliate leaves, flowering, and pod production) and three levels of defoliation (0%; 33% and 67%) were considered. The number of pods per plant (nPPl), number of seeds per pod (nSP), number of seeds per plant (nSPl), mass of seeds per plant (mSPl, g), yield estimate (ePROD, kg ha-1) and mass of one thousand seeds (m1000S, g) were evaluated. The production components of cowpea cv. BRS Bragança varied with the growth stages of the plant and defoliation levels. Defoliation levels do not influence the number of seeds per pod at the three growth stages, although the mass of one thousand seeds is reduced with defoliations of 33 and 67%. Defoliation above 33% at the flowering stage reduces the number of seeds per plant, mass of seeds, and pods per plant, as well as yield estimate. On the other hand, defoliations of 67% reduced the number of pods per plant and seeds per pod at the flowering and pod production stages, respectively.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1806-66902017000500840&lng=en&tlng=enVigna unguiculataNúmero de vagens por plantaNúmero de sementes por vagemMassa sementes por planta
collection DOAJ
language English
format Article
sources DOAJ
author Oscar José Smiderle
Hyanameyka Evangelista de Lima-Primo
Haroldo Duarte Barbosa
Aline das Graças Souza
spellingShingle Oscar José Smiderle
Hyanameyka Evangelista de Lima-Primo
Haroldo Duarte Barbosa
Aline das Graças Souza
Effect of defoliation on production components at different growth stages of cowpea
Revista Ciência Agronômica
Vigna unguiculata
Número de vagens por planta
Número de sementes por vagem
Massa sementes por planta
author_facet Oscar José Smiderle
Hyanameyka Evangelista de Lima-Primo
Haroldo Duarte Barbosa
Aline das Graças Souza
author_sort Oscar José Smiderle
title Effect of defoliation on production components at different growth stages of cowpea
title_short Effect of defoliation on production components at different growth stages of cowpea
title_full Effect of defoliation on production components at different growth stages of cowpea
title_fullStr Effect of defoliation on production components at different growth stages of cowpea
title_full_unstemmed Effect of defoliation on production components at different growth stages of cowpea
title_sort effect of defoliation on production components at different growth stages of cowpea
publisher Universidade Federal do Ceará
series Revista Ciência Agronômica
issn 1806-6690
description ABSTRACT Cowpea (Vigna unguiculata (L.) Walp.) is an important crop for food and the main source of plant protein for tropical and subtropical regions of the world. The objective of this study was to verify the influence of defoliation levels in three stages of development of cowpea plants cv. 'BRS Bragança' on production components. The experiment was carried out at Embrapa Roraima in a greenhouse adopting the completely randomized design with five replications arranged in a factorial scheme 3 x 3. Three phenological stages (trifoliate leaves, flowering, and pod production) and three levels of defoliation (0%; 33% and 67%) were considered. The number of pods per plant (nPPl), number of seeds per pod (nSP), number of seeds per plant (nSPl), mass of seeds per plant (mSPl, g), yield estimate (ePROD, kg ha-1) and mass of one thousand seeds (m1000S, g) were evaluated. The production components of cowpea cv. BRS Bragança varied with the growth stages of the plant and defoliation levels. Defoliation levels do not influence the number of seeds per pod at the three growth stages, although the mass of one thousand seeds is reduced with defoliations of 33 and 67%. Defoliation above 33% at the flowering stage reduces the number of seeds per plant, mass of seeds, and pods per plant, as well as yield estimate. On the other hand, defoliations of 67% reduced the number of pods per plant and seeds per pod at the flowering and pod production stages, respectively.
topic Vigna unguiculata
Número de vagens por planta
Número de sementes por vagem
Massa sementes por planta
url http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1806-66902017000500840&lng=en&tlng=en
work_keys_str_mv AT oscarjosesmiderle effectofdefoliationonproductioncomponentsatdifferentgrowthstagesofcowpea
AT hyanameykaevangelistadelimaprimo effectofdefoliationonproductioncomponentsatdifferentgrowthstagesofcowpea
AT haroldoduartebarbosa effectofdefoliationonproductioncomponentsatdifferentgrowthstagesofcowpea
AT alinedasgracassouza effectofdefoliationonproductioncomponentsatdifferentgrowthstagesofcowpea
_version_ 1725010074463633408