Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?

Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymp...

Full description

Bibliographic Details
Main Authors: Sujal Ghosh, Ingo Drexler, Sanil Bhatia, Heiko Adler, Andrew R. Gennery, Arndt Borkhardt
Format: Article
Language:English
Published: Frontiers Media S.A. 2018-05-01
Series:Frontiers in Immunology
Subjects:
Online Access:https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/full
id doaj-8cfc7576dc084871a7e6dc6b52314fe4
record_format Article
spelling doaj-8cfc7576dc084871a7e6dc6b52314fe42020-11-24T20:56:10ZengFrontiers Media S.A.Frontiers in Immunology1664-32242018-05-01910.3389/fimmu.2018.00979323684Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?Sujal Ghosh0Ingo Drexler1Sanil Bhatia2Heiko Adler3Heiko Adler4Heiko Adler5Andrew R. Gennery6Arndt Borkhardt7Department of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyInstitute for Virology, Medical Faculty, Heinrich-Heine-Universität Düsseldorf, Düsseldorf, GermanyDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyResearch Unit Lung Repair and Regeneration, Comprehensive Pneumology Center, Helmholtz Zentrum München—Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH), Munich, GermanyUniversity Hospital Grosshadern, Ludwig-Maximilians-Universität München, Munich, GermanyGerman Center for Lung Research (DZL), Giessen, GermanyPaediatric Immunology and HSCT, Newcastle University and Great North Children's Hospital, Newcastle upon Tyne, United KingdomDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyPatients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency.https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/fullprimary immunodeficiencycombined immunodeficiencyinterleukin-2-inducible T-cell kinaseEpstein–Barr virus-related malignancieslymphoproliferative disorders
collection DOAJ
language English
format Article
sources DOAJ
author Sujal Ghosh
Ingo Drexler
Sanil Bhatia
Heiko Adler
Heiko Adler
Heiko Adler
Andrew R. Gennery
Arndt Borkhardt
spellingShingle Sujal Ghosh
Ingo Drexler
Sanil Bhatia
Heiko Adler
Heiko Adler
Heiko Adler
Andrew R. Gennery
Arndt Borkhardt
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
Frontiers in Immunology
primary immunodeficiency
combined immunodeficiency
interleukin-2-inducible T-cell kinase
Epstein–Barr virus-related malignancies
lymphoproliferative disorders
author_facet Sujal Ghosh
Ingo Drexler
Sanil Bhatia
Heiko Adler
Heiko Adler
Heiko Adler
Andrew R. Gennery
Arndt Borkhardt
author_sort Sujal Ghosh
title Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_short Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_full Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_fullStr Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_full_unstemmed Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_sort interleukin-2-inducible t-cell kinase deficiency—new patients, new insight?
publisher Frontiers Media S.A.
series Frontiers in Immunology
issn 1664-3224
publishDate 2018-05-01
description Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency.
topic primary immunodeficiency
combined immunodeficiency
interleukin-2-inducible T-cell kinase
Epstein–Barr virus-related malignancies
lymphoproliferative disorders
url https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/full
work_keys_str_mv AT sujalghosh interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT ingodrexler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT sanilbhatia interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT andrewrgennery interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT arndtborkhardt interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
_version_ 1716790484455653376