Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymp...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2018-05-01
|
Series: | Frontiers in Immunology |
Subjects: | |
Online Access: | https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/full |
id |
doaj-8cfc7576dc084871a7e6dc6b52314fe4 |
---|---|
record_format |
Article |
spelling |
doaj-8cfc7576dc084871a7e6dc6b52314fe42020-11-24T20:56:10ZengFrontiers Media S.A.Frontiers in Immunology1664-32242018-05-01910.3389/fimmu.2018.00979323684Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?Sujal Ghosh0Ingo Drexler1Sanil Bhatia2Heiko Adler3Heiko Adler4Heiko Adler5Andrew R. Gennery6Arndt Borkhardt7Department of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyInstitute for Virology, Medical Faculty, Heinrich-Heine-Universität Düsseldorf, Düsseldorf, GermanyDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyResearch Unit Lung Repair and Regeneration, Comprehensive Pneumology Center, Helmholtz Zentrum München—Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH), Munich, GermanyUniversity Hospital Grosshadern, Ludwig-Maximilians-Universität München, Munich, GermanyGerman Center for Lung Research (DZL), Giessen, GermanyPaediatric Immunology and HSCT, Newcastle University and Great North Children's Hospital, Newcastle upon Tyne, United KingdomDepartment of Pediatric Oncology, Hematology and Clinical Immunology, Medical Faculty, Center of Child and Adolescent Health, Heinrich-Heine-University, Düsseldorf, GermanyPatients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency.https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/fullprimary immunodeficiencycombined immunodeficiencyinterleukin-2-inducible T-cell kinaseEpstein–Barr virus-related malignancieslymphoproliferative disorders |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt |
spellingShingle |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? Frontiers in Immunology primary immunodeficiency combined immunodeficiency interleukin-2-inducible T-cell kinase Epstein–Barr virus-related malignancies lymphoproliferative disorders |
author_facet |
Sujal Ghosh Ingo Drexler Sanil Bhatia Heiko Adler Heiko Adler Heiko Adler Andrew R. Gennery Arndt Borkhardt |
author_sort |
Sujal Ghosh |
title |
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_short |
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full |
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_fullStr |
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full_unstemmed |
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_sort |
interleukin-2-inducible t-cell kinase deficiency—new patients, new insight? |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Immunology |
issn |
1664-3224 |
publishDate |
2018-05-01 |
description |
Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency. |
topic |
primary immunodeficiency combined immunodeficiency interleukin-2-inducible T-cell kinase Epstein–Barr virus-related malignancies lymphoproliferative disorders |
url |
https://www.frontiersin.org/article/10.3389/fimmu.2018.00979/full |
work_keys_str_mv |
AT sujalghosh interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT ingodrexler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT sanilbhatia interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT heikoadler interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT andrewrgennery interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT arndtborkhardt interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight |
_version_ |
1716790484455653376 |