Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton

<p>Abstract</p> <p>Background</p> <p>The guanine nucleotide exchange factor C3G (RapGEF1) along with its effector proteins participates in signaling pathways that regulate eukaryotic cell proliferation, adhesion, apoptosis and embryonic development. It activates Rap1, R...

Full description

Bibliographic Details
Main Authors: Radha Vegesna, Rajanna Ajumeera, Swarup Ghanshyam
Format: Article
Language:English
Published: BMC 2004-08-01
Series:BMC Cell Biology
Online Access:http://www.biomedcentral.com/1471-2121/5/31
id doaj-8832dfbf517c4ccaaa0c11f2fbb436cf
record_format Article
spelling doaj-8832dfbf517c4ccaaa0c11f2fbb436cf2020-11-24T20:57:17ZengBMCBMC Cell Biology1471-21212004-08-01513110.1186/1471-2121-5-31Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeletonRadha VegesnaRajanna AjumeeraSwarup Ghanshyam<p>Abstract</p> <p>Background</p> <p>The guanine nucleotide exchange factor C3G (RapGEF1) along with its effector proteins participates in signaling pathways that regulate eukaryotic cell proliferation, adhesion, apoptosis and embryonic development. It activates Rap1, Rap2 and R-Ras members of the Ras family of GTPases. C3G is activated upon phosphorylation at tyrosine 504 and therefore, determining the localization of phosphorylated C3G would provide an insight into its site of action in the cellular context.</p> <p>Results</p> <p>C3G is phosphorylated in vivo on Y504 upon coexpression with Src or Hck, two members of the Src family tyrosine kinases. Here we have determined the subcellular localization of this protein using antibodies specific to C3G and Tyr 504 phosphorylated C3G (pY504 C3G). While exogenously expressed C3G was present mostly in the cytosol, pY504 C3G formed upon Hck or Src coexpression localized predominantly at the cell membrane and the Golgi complex. Tyrosine 504-phosphorylated C3G showed colocalization with Hck and Src. Treatment of Hck and C3G transfected cells with pervanadate showed an increase in the cytosolic staining of pY504 C3G suggesting that tyrosine phosphatases may be involved in dephosphorylating cytosolic phospho-C3G. Expression of Src family kinases or treatment of cells with pervanadate resulted in an increase in endogenous pY504 C3G, which was localized predominantly at the Golgi and the cell periphery. Endogenous pY504 C3G at the cell periphery colocalized with F-actin suggesting its presence at the subcortical actin cytoskeleton. Disruption of actin cytoskeleton by cytochalasin D abolished phospho-C3G staining at the periphery of the cell without affecting its Golgi localization.</p> <p>Conclusions</p> <p>These findings show that tyrosine kinases involved in phosphorylation of C3G are responsible for regulation of its localization in a cellular context. We have demonstrated the localization of endogenous C3G modified by tyrosine phosphorylation to defined subcellular domains where it may be responsible for restricted activation of signaling pathways.</p> http://www.biomedcentral.com/1471-2121/5/31
collection DOAJ
language English
format Article
sources DOAJ
author Radha Vegesna
Rajanna Ajumeera
Swarup Ghanshyam
spellingShingle Radha Vegesna
Rajanna Ajumeera
Swarup Ghanshyam
Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
BMC Cell Biology
author_facet Radha Vegesna
Rajanna Ajumeera
Swarup Ghanshyam
author_sort Radha Vegesna
title Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
title_short Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
title_full Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
title_fullStr Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
title_full_unstemmed Phosphorylated guanine nucleotide exchange factor C3G, induced by pervanadate and Src family kinases localizes to the Golgi and subcortical actin cytoskeleton
title_sort phosphorylated guanine nucleotide exchange factor c3g, induced by pervanadate and src family kinases localizes to the golgi and subcortical actin cytoskeleton
publisher BMC
series BMC Cell Biology
issn 1471-2121
publishDate 2004-08-01
description <p>Abstract</p> <p>Background</p> <p>The guanine nucleotide exchange factor C3G (RapGEF1) along with its effector proteins participates in signaling pathways that regulate eukaryotic cell proliferation, adhesion, apoptosis and embryonic development. It activates Rap1, Rap2 and R-Ras members of the Ras family of GTPases. C3G is activated upon phosphorylation at tyrosine 504 and therefore, determining the localization of phosphorylated C3G would provide an insight into its site of action in the cellular context.</p> <p>Results</p> <p>C3G is phosphorylated in vivo on Y504 upon coexpression with Src or Hck, two members of the Src family tyrosine kinases. Here we have determined the subcellular localization of this protein using antibodies specific to C3G and Tyr 504 phosphorylated C3G (pY504 C3G). While exogenously expressed C3G was present mostly in the cytosol, pY504 C3G formed upon Hck or Src coexpression localized predominantly at the cell membrane and the Golgi complex. Tyrosine 504-phosphorylated C3G showed colocalization with Hck and Src. Treatment of Hck and C3G transfected cells with pervanadate showed an increase in the cytosolic staining of pY504 C3G suggesting that tyrosine phosphatases may be involved in dephosphorylating cytosolic phospho-C3G. Expression of Src family kinases or treatment of cells with pervanadate resulted in an increase in endogenous pY504 C3G, which was localized predominantly at the Golgi and the cell periphery. Endogenous pY504 C3G at the cell periphery colocalized with F-actin suggesting its presence at the subcortical actin cytoskeleton. Disruption of actin cytoskeleton by cytochalasin D abolished phospho-C3G staining at the periphery of the cell without affecting its Golgi localization.</p> <p>Conclusions</p> <p>These findings show that tyrosine kinases involved in phosphorylation of C3G are responsible for regulation of its localization in a cellular context. We have demonstrated the localization of endogenous C3G modified by tyrosine phosphorylation to defined subcellular domains where it may be responsible for restricted activation of signaling pathways.</p>
url http://www.biomedcentral.com/1471-2121/5/31
work_keys_str_mv AT radhavegesna phosphorylatedguaninenucleotideexchangefactorc3ginducedbypervanadateandsrcfamilykinaseslocalizestothegolgiandsubcorticalactincytoskeleton
AT rajannaajumeera phosphorylatedguaninenucleotideexchangefactorc3ginducedbypervanadateandsrcfamilykinaseslocalizestothegolgiandsubcorticalactincytoskeleton
AT swarupghanshyam phosphorylatedguaninenucleotideexchangefactorc3ginducedbypervanadateandsrcfamilykinaseslocalizestothegolgiandsubcorticalactincytoskeleton
_version_ 1716788182207430656