The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery

Summary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this...

Full description

Bibliographic Details
Main Authors: Daniel S.J. Miller, Robert D. Bloxham, Ming Jiang, Ilaria Gori, Rebecca E. Saunders, Debipriya Das, Probir Chakravarty, Michael Howell, Caroline S. Hill
Format: Article
Language:English
Published: Elsevier 2018-11-01
Series:Cell Reports
Online Access:http://www.sciencedirect.com/science/article/pii/S2211124718316450
id doaj-8049e96479684e32936dcbfd58f4f724
record_format Article
spelling doaj-8049e96479684e32936dcbfd58f4f7242020-11-25T01:38:01ZengElsevierCell Reports2211-12472018-11-0125718411855.e5The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT MachineryDaniel S.J. Miller0Robert D. Bloxham1Ming Jiang2Ilaria Gori3Rebecca E. Saunders4Debipriya Das5Probir Chakravarty6Michael Howell7Caroline S. Hill8Developmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKBioinformatics and Biostatistics Facility, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UK; Corresponding authorSummary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this process contributing to human diseases, including cancer. For receptors recognizing ligands of the transforming growth factor β (TGF-β) family, little is known about how trafficking is regulated or how this shapes signaling dynamics. Here, using whole genome small interfering RNA (siRNA) screens, we have identified the ESCRT (endosomal sorting complex required for transport) machinery as a crucial determinant of signal duration. Downregulation of ESCRT components increases the outputs of TGF-β signaling and sensitizes cells to low doses of ligand in their microenvironment. This sensitization drives an epithelial-to-mesenchymal transition (EMT) in response to low doses of ligand, and we demonstrate a link between downregulation of the ESCRT machinery and cancer survival. : Miller et al. demonstrate, using whole genome siRNA screening, that TGF-β receptors are targeted for degradation by the ESCRT machinery. Inhibiting ESCRT components upregulates long-term TGF-β signaling and enhances functional outputs of the pathway to sensitize cells to low levels of ligand in the micro-environment. Keywords: epithelial-to-mesenchymal transition, ESCRT machinery, receptor trafficking, signaling dynamics, SMAD2, TGF-βhttp://www.sciencedirect.com/science/article/pii/S2211124718316450
collection DOAJ
language English
format Article
sources DOAJ
author Daniel S.J. Miller
Robert D. Bloxham
Ming Jiang
Ilaria Gori
Rebecca E. Saunders
Debipriya Das
Probir Chakravarty
Michael Howell
Caroline S. Hill
spellingShingle Daniel S.J. Miller
Robert D. Bloxham
Ming Jiang
Ilaria Gori
Rebecca E. Saunders
Debipriya Das
Probir Chakravarty
Michael Howell
Caroline S. Hill
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
Cell Reports
author_facet Daniel S.J. Miller
Robert D. Bloxham
Ming Jiang
Ilaria Gori
Rebecca E. Saunders
Debipriya Das
Probir Chakravarty
Michael Howell
Caroline S. Hill
author_sort Daniel S.J. Miller
title The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
title_short The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
title_full The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
title_fullStr The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
title_full_unstemmed The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
title_sort dynamics of tgf-β signaling are dictated by receptor trafficking via the escrt machinery
publisher Elsevier
series Cell Reports
issn 2211-1247
publishDate 2018-11-01
description Summary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this process contributing to human diseases, including cancer. For receptors recognizing ligands of the transforming growth factor β (TGF-β) family, little is known about how trafficking is regulated or how this shapes signaling dynamics. Here, using whole genome small interfering RNA (siRNA) screens, we have identified the ESCRT (endosomal sorting complex required for transport) machinery as a crucial determinant of signal duration. Downregulation of ESCRT components increases the outputs of TGF-β signaling and sensitizes cells to low doses of ligand in their microenvironment. This sensitization drives an epithelial-to-mesenchymal transition (EMT) in response to low doses of ligand, and we demonstrate a link between downregulation of the ESCRT machinery and cancer survival. : Miller et al. demonstrate, using whole genome siRNA screening, that TGF-β receptors are targeted for degradation by the ESCRT machinery. Inhibiting ESCRT components upregulates long-term TGF-β signaling and enhances functional outputs of the pathway to sensitize cells to low levels of ligand in the micro-environment. Keywords: epithelial-to-mesenchymal transition, ESCRT machinery, receptor trafficking, signaling dynamics, SMAD2, TGF-β
url http://www.sciencedirect.com/science/article/pii/S2211124718316450
work_keys_str_mv AT danielsjmiller thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT robertdbloxham thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT mingjiang thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT ilariagori thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT rebeccaesaunders thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT debipriyadas thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT probirchakravarty thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT michaelhowell thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT carolineshill thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT danielsjmiller dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT robertdbloxham dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT mingjiang dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT ilariagori dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT rebeccaesaunders dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT debipriyadas dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT probirchakravarty dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT michaelhowell dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
AT carolineshill dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery
_version_ 1725055681995735040