The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery
Summary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this...
Main Authors: | , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Elsevier
2018-11-01
|
Series: | Cell Reports |
Online Access: | http://www.sciencedirect.com/science/article/pii/S2211124718316450 |
id |
doaj-8049e96479684e32936dcbfd58f4f724 |
---|---|
record_format |
Article |
spelling |
doaj-8049e96479684e32936dcbfd58f4f7242020-11-25T01:38:01ZengElsevierCell Reports2211-12472018-11-0125718411855.e5The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT MachineryDaniel S.J. Miller0Robert D. Bloxham1Ming Jiang2Ilaria Gori3Rebecca E. Saunders4Debipriya Das5Probir Chakravarty6Michael Howell7Caroline S. Hill8Developmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKBioinformatics and Biostatistics Facility, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKHigh Throughput Screening Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UKDevelopmental Signalling Laboratory, The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UK; Corresponding authorSummary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this process contributing to human diseases, including cancer. For receptors recognizing ligands of the transforming growth factor β (TGF-β) family, little is known about how trafficking is regulated or how this shapes signaling dynamics. Here, using whole genome small interfering RNA (siRNA) screens, we have identified the ESCRT (endosomal sorting complex required for transport) machinery as a crucial determinant of signal duration. Downregulation of ESCRT components increases the outputs of TGF-β signaling and sensitizes cells to low doses of ligand in their microenvironment. This sensitization drives an epithelial-to-mesenchymal transition (EMT) in response to low doses of ligand, and we demonstrate a link between downregulation of the ESCRT machinery and cancer survival. : Miller et al. demonstrate, using whole genome siRNA screening, that TGF-β receptors are targeted for degradation by the ESCRT machinery. Inhibiting ESCRT components upregulates long-term TGF-β signaling and enhances functional outputs of the pathway to sensitize cells to low levels of ligand in the micro-environment. Keywords: epithelial-to-mesenchymal transition, ESCRT machinery, receptor trafficking, signaling dynamics, SMAD2, TGF-βhttp://www.sciencedirect.com/science/article/pii/S2211124718316450 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Daniel S.J. Miller Robert D. Bloxham Ming Jiang Ilaria Gori Rebecca E. Saunders Debipriya Das Probir Chakravarty Michael Howell Caroline S. Hill |
spellingShingle |
Daniel S.J. Miller Robert D. Bloxham Ming Jiang Ilaria Gori Rebecca E. Saunders Debipriya Das Probir Chakravarty Michael Howell Caroline S. Hill The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery Cell Reports |
author_facet |
Daniel S.J. Miller Robert D. Bloxham Ming Jiang Ilaria Gori Rebecca E. Saunders Debipriya Das Probir Chakravarty Michael Howell Caroline S. Hill |
author_sort |
Daniel S.J. Miller |
title |
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery |
title_short |
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery |
title_full |
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery |
title_fullStr |
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery |
title_full_unstemmed |
The Dynamics of TGF-β Signaling Are Dictated by Receptor Trafficking via the ESCRT Machinery |
title_sort |
dynamics of tgf-β signaling are dictated by receptor trafficking via the escrt machinery |
publisher |
Elsevier |
series |
Cell Reports |
issn |
2211-1247 |
publishDate |
2018-11-01 |
description |
Summary: Signal transduction pathways stimulated by secreted growth factors are tightly regulated at multiple levels between the cell surface and the nucleus. The trafficking of cell surface receptors is emerging as a key step for regulating appropriate cellular responses, with perturbations in this process contributing to human diseases, including cancer. For receptors recognizing ligands of the transforming growth factor β (TGF-β) family, little is known about how trafficking is regulated or how this shapes signaling dynamics. Here, using whole genome small interfering RNA (siRNA) screens, we have identified the ESCRT (endosomal sorting complex required for transport) machinery as a crucial determinant of signal duration. Downregulation of ESCRT components increases the outputs of TGF-β signaling and sensitizes cells to low doses of ligand in their microenvironment. This sensitization drives an epithelial-to-mesenchymal transition (EMT) in response to low doses of ligand, and we demonstrate a link between downregulation of the ESCRT machinery and cancer survival. : Miller et al. demonstrate, using whole genome siRNA screening, that TGF-β receptors are targeted for degradation by the ESCRT machinery. Inhibiting ESCRT components upregulates long-term TGF-β signaling and enhances functional outputs of the pathway to sensitize cells to low levels of ligand in the micro-environment. Keywords: epithelial-to-mesenchymal transition, ESCRT machinery, receptor trafficking, signaling dynamics, SMAD2, TGF-β |
url |
http://www.sciencedirect.com/science/article/pii/S2211124718316450 |
work_keys_str_mv |
AT danielsjmiller thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT robertdbloxham thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT mingjiang thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT ilariagori thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT rebeccaesaunders thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT debipriyadas thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT probirchakravarty thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT michaelhowell thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT carolineshill thedynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT danielsjmiller dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT robertdbloxham dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT mingjiang dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT ilariagori dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT rebeccaesaunders dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT debipriyadas dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT probirchakravarty dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT michaelhowell dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery AT carolineshill dynamicsoftgfbsignalingaredictatedbyreceptortraffickingviatheescrtmachinery |
_version_ |
1725055681995735040 |