agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma

The accumulating evidences show that Abrus agglutinin, a plant lectin, displays a broad range of anticancer activity including cancer-specific induction of apoptosis; however, the underlying molecular mechanism of Abrus agglutinin–induced oral cancer stem cell elimination remains elusive. Our data d...

Full description

Bibliographic Details
Main Authors: Niharika Sinha, Prashanta Kumar Panda, Prajna Paramita Naik, Tapas K Maiti, Sujit K Bhutia
Format: Article
Language:English
Published: IOS Press 2017-04-01
Series:Tumor Biology
Online Access:https://doi.org/10.1177/1010428317701634
id doaj-73849a60b1c3484cb987b442f4bb2d24
record_format Article
spelling doaj-73849a60b1c3484cb987b442f4bb2d242021-05-02T18:14:01ZengIOS PressTumor Biology1423-03802017-04-013910.1177/1010428317701634 agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinomaNiharika Sinha0Prashanta Kumar Panda1Prajna Paramita Naik2Tapas K Maiti3Sujit K Bhutia4Department of Life science, National Institute of Technology Rourkela, Rourkela, IndiaDepartment of Life science, National Institute of Technology Rourkela, Rourkela, IndiaDepartment of Life science, National Institute of Technology Rourkela, Rourkela, IndiaDepartment of Biotechnology, Indian Institute of Technology Kharagpur, Kharagpur, IndiaDepartment of Life science, National Institute of Technology Rourkela, Rourkela, IndiaThe accumulating evidences show that Abrus agglutinin, a plant lectin, displays a broad range of anticancer activity including cancer-specific induction of apoptosis; however, the underlying molecular mechanism of Abrus agglutinin–induced oral cancer stem cell elimination remains elusive. Our data documented that Abrus agglutinin effectively downregulated the CD44 + expression with the increased CD44 − population in different oral cancer cells. After 24-h Abrus agglutinin treatment, FaDu cells were quantified for orosphere formation in ultra-low attachment plates and data showed that Abrus agglutinin inhibited the number and size of orosphere in a dose-dependent manner in FaDu cells. Furthermore, Abrus agglutinin hindered the plasticity of FaDu orospheres as supported by reduced sphere formation and downregulated the self-renewal property via inhibition of Wnt-β-catenin signaling pathway. Introduction of LiCl, a glycogen synthase kinase 3β inhibitor, rescued the Abrus agglutinin–stimulated inhibition of β-catenin and phosphorylated glycogen synthase kinase 3β in FaDu cell–derived orospheres confirming importance of Wnt signaling in Abrus agglutinin–mediated inhibition of stemness. In this connection, our data showed that Abrus agglutinin restrained proliferation and induced apoptosis in FaDu-derived cancer stem cells in dose-dependent manner. Moreover, western blot data demonstrated that Abrus agglutinin increased the Bax/Bcl-2 ratio with activation of poly(adenosine diphosphate–ribose) polymerase and caspase-3 favoring apoptosis induction in orospheres. Abrus agglutinin induced reactive oxygen species accumulation in orospheres and pretreatment of N -acetyl cysteine, and a reactive oxygen species scavenger inhibited Abrus agglutinin–mediated caspase-3 activity and β-catenin expression indicating reactive oxygen species as a principal regulator of Wnt signaling and apoptosis. In conclusion, Abrus agglutinin has a potential role as an integrative therapeutic approach for combating oral cancer through targeting self-renewability of orospheres via reactive oxygen species–mediated apoptosis.https://doi.org/10.1177/1010428317701634
collection DOAJ
language English
format Article
sources DOAJ
author Niharika Sinha
Prashanta Kumar Panda
Prajna Paramita Naik
Tapas K Maiti
Sujit K Bhutia
spellingShingle Niharika Sinha
Prashanta Kumar Panda
Prajna Paramita Naik
Tapas K Maiti
Sujit K Bhutia
agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
Tumor Biology
author_facet Niharika Sinha
Prashanta Kumar Panda
Prajna Paramita Naik
Tapas K Maiti
Sujit K Bhutia
author_sort Niharika Sinha
title agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
title_short agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
title_full agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
title_fullStr agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
title_full_unstemmed agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
title_sort agglutinin targets cancer stem-like cells by eliminating self-renewal capacity accompanied with apoptosis in oral squamous cell carcinoma
publisher IOS Press
series Tumor Biology
issn 1423-0380
publishDate 2017-04-01
description The accumulating evidences show that Abrus agglutinin, a plant lectin, displays a broad range of anticancer activity including cancer-specific induction of apoptosis; however, the underlying molecular mechanism of Abrus agglutinin–induced oral cancer stem cell elimination remains elusive. Our data documented that Abrus agglutinin effectively downregulated the CD44 + expression with the increased CD44 − population in different oral cancer cells. After 24-h Abrus agglutinin treatment, FaDu cells were quantified for orosphere formation in ultra-low attachment plates and data showed that Abrus agglutinin inhibited the number and size of orosphere in a dose-dependent manner in FaDu cells. Furthermore, Abrus agglutinin hindered the plasticity of FaDu orospheres as supported by reduced sphere formation and downregulated the self-renewal property via inhibition of Wnt-β-catenin signaling pathway. Introduction of LiCl, a glycogen synthase kinase 3β inhibitor, rescued the Abrus agglutinin–stimulated inhibition of β-catenin and phosphorylated glycogen synthase kinase 3β in FaDu cell–derived orospheres confirming importance of Wnt signaling in Abrus agglutinin–mediated inhibition of stemness. In this connection, our data showed that Abrus agglutinin restrained proliferation and induced apoptosis in FaDu-derived cancer stem cells in dose-dependent manner. Moreover, western blot data demonstrated that Abrus agglutinin increased the Bax/Bcl-2 ratio with activation of poly(adenosine diphosphate–ribose) polymerase and caspase-3 favoring apoptosis induction in orospheres. Abrus agglutinin induced reactive oxygen species accumulation in orospheres and pretreatment of N -acetyl cysteine, and a reactive oxygen species scavenger inhibited Abrus agglutinin–mediated caspase-3 activity and β-catenin expression indicating reactive oxygen species as a principal regulator of Wnt signaling and apoptosis. In conclusion, Abrus agglutinin has a potential role as an integrative therapeutic approach for combating oral cancer through targeting self-renewability of orospheres via reactive oxygen species–mediated apoptosis.
url https://doi.org/10.1177/1010428317701634
work_keys_str_mv AT niharikasinha agglutinintargetscancerstemlikecellsbyeliminatingselfrenewalcapacityaccompaniedwithapoptosisinoralsquamouscellcarcinoma
AT prashantakumarpanda agglutinintargetscancerstemlikecellsbyeliminatingselfrenewalcapacityaccompaniedwithapoptosisinoralsquamouscellcarcinoma
AT prajnaparamitanaik agglutinintargetscancerstemlikecellsbyeliminatingselfrenewalcapacityaccompaniedwithapoptosisinoralsquamouscellcarcinoma
AT tapaskmaiti agglutinintargetscancerstemlikecellsbyeliminatingselfrenewalcapacityaccompaniedwithapoptosisinoralsquamouscellcarcinoma
AT sujitkbhutia agglutinintargetscancerstemlikecellsbyeliminatingselfrenewalcapacityaccompaniedwithapoptosisinoralsquamouscellcarcinoma
_version_ 1721488998585597952