Inherent and antigen-induced airway hyperreactivity in NC mice
In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Elsevier
1999-01-01
|
Series: | Allergology International |
Subjects: | |
Online Access: | http://www.sciencedirect.com/science/article/pii/S1323893015314775 |
id |
doaj-6ac6bbc480684470b579f0d2c1b934e9 |
---|---|
record_format |
Article |
spelling |
doaj-6ac6bbc480684470b579f0d2c1b934e92020-11-24T23:59:34ZengElsevierAllergology International1323-89301999-01-0148212913510.1046/j.1440-1592.1999.00127.xInherent and antigen-induced airway hyperreactivity in NC miceTetsuto KobayashiToru MiuraTomoko HabaMiyuki SatoMasao TakeiIsao SerizawaIn order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.http://www.sciencedirect.com/science/article/pii/S1323893015314775airway hyperreactivityasthmagenetic regulationinbred strainsinflammationNC mice |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Tetsuto Kobayashi Toru Miura Tomoko Haba Miyuki Sato Masao Takei Isao Serizawa |
spellingShingle |
Tetsuto Kobayashi Toru Miura Tomoko Haba Miyuki Sato Masao Takei Isao Serizawa Inherent and antigen-induced airway hyperreactivity in NC mice Allergology International airway hyperreactivity asthma genetic regulation inbred strains inflammation NC mice |
author_facet |
Tetsuto Kobayashi Toru Miura Tomoko Haba Miyuki Sato Masao Takei Isao Serizawa |
author_sort |
Tetsuto Kobayashi |
title |
Inherent and antigen-induced airway hyperreactivity in NC mice |
title_short |
Inherent and antigen-induced airway hyperreactivity in NC mice |
title_full |
Inherent and antigen-induced airway hyperreactivity in NC mice |
title_fullStr |
Inherent and antigen-induced airway hyperreactivity in NC mice |
title_full_unstemmed |
Inherent and antigen-induced airway hyperreactivity in NC mice |
title_sort |
inherent and antigen-induced airway hyperreactivity in nc mice |
publisher |
Elsevier |
series |
Allergology International |
issn |
1323-8930 |
publishDate |
1999-01-01 |
description |
In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma. |
topic |
airway hyperreactivity asthma genetic regulation inbred strains inflammation NC mice |
url |
http://www.sciencedirect.com/science/article/pii/S1323893015314775 |
work_keys_str_mv |
AT tetsutokobayashi inherentandantigeninducedairwayhyperreactivityinncmice AT torumiura inherentandantigeninducedairwayhyperreactivityinncmice AT tomokohaba inherentandantigeninducedairwayhyperreactivityinncmice AT miyukisato inherentandantigeninducedairwayhyperreactivityinncmice AT masaotakei inherentandantigeninducedairwayhyperreactivityinncmice AT isaoserizawa inherentandantigeninducedairwayhyperreactivityinncmice |
_version_ |
1725447403106992128 |