The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putre...
Main Authors: | , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2021-06-01
|
Series: | Frontiers in Microbiology |
Subjects: | |
Online Access: | https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/full |
id |
doaj-5f14069b31ce4a698e6fdf1febc4d7d0 |
---|---|
record_format |
Article |
spelling |
doaj-5f14069b31ce4a698e6fdf1febc4d7d02021-07-15T18:59:48ZengFrontiers Media S.A.Frontiers in Microbiology1664-302X2021-06-011210.3389/fmicb.2021.668892668892The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciensAnna Pecina0Meike Schwan1Vitan Blagotinsek2Tim Rick3Patrick Klüber4Tabea Leonhard5Gert Bange6Kai M. Thormann7Department of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Chemistry, SYNMIKRO Research Center, Philipps-University Marburg, Marburg, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Chemistry, SYNMIKRO Research Center, Philipps-University Marburg, Marburg, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyA number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria.https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/fullflagellac-di-GMPflagellar motorYcgRShewanellaPilZ domain |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Anna Pecina Meike Schwan Vitan Blagotinsek Tim Rick Patrick Klüber Tabea Leonhard Gert Bange Kai M. Thormann |
spellingShingle |
Anna Pecina Meike Schwan Vitan Blagotinsek Tim Rick Patrick Klüber Tabea Leonhard Gert Bange Kai M. Thormann The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens Frontiers in Microbiology flagella c-di-GMP flagellar motor YcgR Shewanella PilZ domain |
author_facet |
Anna Pecina Meike Schwan Vitan Blagotinsek Tim Rick Patrick Klüber Tabea Leonhard Gert Bange Kai M. Thormann |
author_sort |
Anna Pecina |
title |
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
title_short |
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
title_full |
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
title_fullStr |
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
title_full_unstemmed |
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
title_sort |
stand-alone pilz-domain protein motl specifically regulates the activity of the secondary lateral flagellar system in shewanella putrefaciens |
publisher |
Frontiers Media S.A. |
series |
Frontiers in Microbiology |
issn |
1664-302X |
publishDate |
2021-06-01 |
description |
A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria. |
topic |
flagella c-di-GMP flagellar motor YcgR Shewanella PilZ domain |
url |
https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/full |
work_keys_str_mv |
AT annapecina thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT meikeschwan thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT vitanblagotinsek thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT timrick thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT patrickkluber thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT tabealeonhard thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT gertbange thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT kaimthormann thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT annapecina standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT meikeschwan standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT vitanblagotinsek standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT timrick standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT patrickkluber standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT tabealeonhard standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT gertbange standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT kaimthormann standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens |
_version_ |
1721298071087742976 |