The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens

A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putre...

Full description

Bibliographic Details
Main Authors: Anna Pecina, Meike Schwan, Vitan Blagotinsek, Tim Rick, Patrick Klüber, Tabea Leonhard, Gert Bange, Kai M. Thormann
Format: Article
Language:English
Published: Frontiers Media S.A. 2021-06-01
Series:Frontiers in Microbiology
Subjects:
Online Access:https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/full
id doaj-5f14069b31ce4a698e6fdf1febc4d7d0
record_format Article
spelling doaj-5f14069b31ce4a698e6fdf1febc4d7d02021-07-15T18:59:48ZengFrontiers Media S.A.Frontiers in Microbiology1664-302X2021-06-011210.3389/fmicb.2021.668892668892The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciensAnna Pecina0Meike Schwan1Vitan Blagotinsek2Tim Rick3Patrick Klüber4Tabea Leonhard5Gert Bange6Kai M. Thormann7Department of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Chemistry, SYNMIKRO Research Center, Philipps-University Marburg, Marburg, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyDepartment of Chemistry, SYNMIKRO Research Center, Philipps-University Marburg, Marburg, GermanyDepartment of Microbiology and Molecular Biology, Justus-Liebig-Universität Gießen, Giessen, GermanyA number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria.https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/fullflagellac-di-GMPflagellar motorYcgRShewanellaPilZ domain
collection DOAJ
language English
format Article
sources DOAJ
author Anna Pecina
Meike Schwan
Vitan Blagotinsek
Tim Rick
Patrick Klüber
Tabea Leonhard
Gert Bange
Kai M. Thormann
spellingShingle Anna Pecina
Meike Schwan
Vitan Blagotinsek
Tim Rick
Patrick Klüber
Tabea Leonhard
Gert Bange
Kai M. Thormann
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
Frontiers in Microbiology
flagella
c-di-GMP
flagellar motor
YcgR
Shewanella
PilZ domain
author_facet Anna Pecina
Meike Schwan
Vitan Blagotinsek
Tim Rick
Patrick Klüber
Tabea Leonhard
Gert Bange
Kai M. Thormann
author_sort Anna Pecina
title The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_short The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_full The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_fullStr The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_full_unstemmed The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_sort stand-alone pilz-domain protein motl specifically regulates the activity of the secondary lateral flagellar system in shewanella putrefaciens
publisher Frontiers Media S.A.
series Frontiers in Microbiology
issn 1664-302X
publishDate 2021-06-01
description A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria.
topic flagella
c-di-GMP
flagellar motor
YcgR
Shewanella
PilZ domain
url https://www.frontiersin.org/articles/10.3389/fmicb.2021.668892/full
work_keys_str_mv AT annapecina thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT meikeschwan thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT vitanblagotinsek thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT timrick thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT patrickkluber thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT tabealeonhard thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT gertbange thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT kaimthormann thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT annapecina standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT meikeschwan standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT vitanblagotinsek standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT timrick standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT patrickkluber standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT tabealeonhard standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT gertbange standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT kaimthormann standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
_version_ 1721298071087742976