Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook

Abstract Background Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool a...

Full description

Bibliographic Details
Main Authors: Ognjen Barcot, Matija Boric, Tina Poklepovic Pericic, Marija Cavar, Svjetlana Dosenovic, Ivana Vuka, Livia Puljak
Format: Article
Language:English
Published: BMC 2019-08-01
Series:BMC Medical Research Methodology
Subjects:
Online Access:http://link.springer.com/article/10.1186/s12874-019-0804-y
id doaj-5858e94013a94a01a85f20ebd2b6d60f
record_format Article
spelling doaj-5858e94013a94a01a85f20ebd2b6d60f2020-11-25T03:10:22ZengBMCBMC Medical Research Methodology1471-22882019-08-0119111010.1186/s12874-019-0804-yRisk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane HandbookOgnjen Barcot0Matija Boric1Tina Poklepovic Pericic2Marija Cavar3Svjetlana Dosenovic4Ivana Vuka5Livia Puljak6Department of Surgery, University Hospital SplitDepartment of Surgery, University Hospital SplitDepartment for Research in Biomedicine and Health, University of Split, School of MedicineDepartment of Radiology, University Hospital SplitDepartment of Anesthesiology and Intensive Care, University Hospital SplitDepartment for Research in Biomedicine and Health, University of Split, School of MedicineCenter for Evidence-Based Medicine and Health Care, Catholic University of CroatiaAbstract Background Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. Methods We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. Results We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". Conclusion Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials.http://link.springer.com/article/10.1186/s12874-019-0804-yRisk of biasCochraneSystematic reviewsRandomisationSequence generationSelection bias
collection DOAJ
language English
format Article
sources DOAJ
author Ognjen Barcot
Matija Boric
Tina Poklepovic Pericic
Marija Cavar
Svjetlana Dosenovic
Ivana Vuka
Livia Puljak
spellingShingle Ognjen Barcot
Matija Boric
Tina Poklepovic Pericic
Marija Cavar
Svjetlana Dosenovic
Ivana Vuka
Livia Puljak
Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
BMC Medical Research Methodology
Risk of bias
Cochrane
Systematic reviews
Randomisation
Sequence generation
Selection bias
author_facet Ognjen Barcot
Matija Boric
Tina Poklepovic Pericic
Marija Cavar
Svjetlana Dosenovic
Ivana Vuka
Livia Puljak
author_sort Ognjen Barcot
title Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_short Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_full Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_fullStr Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_full_unstemmed Risk of bias judgments for random sequence generation in Cochrane systematic reviews were frequently not in line with Cochrane Handbook
title_sort risk of bias judgments for random sequence generation in cochrane systematic reviews were frequently not in line with cochrane handbook
publisher BMC
series BMC Medical Research Methodology
issn 1471-2288
publishDate 2019-08-01
description Abstract Background Assessing the risk of bias (RoB) in included studies is one of the key methodological aspects of systematic reviews. Cochrane systematic reviews appraise RoB of randomised controlled trials (RCTs) with the Cochrane RoB tool. Detailed instructions for using the Cochrane RoB tool are provided in the Cochrane Handbook for Systematic Reviews of Interventions (The Cochrane Handbook). The purpose of this study was to analyse whether Cochrane authors use adequate judgments about the RoB for random sequence generation of RCTs included in Cochrane reviews. Methods We extracted authors’ judgments (high, low or unclear RoB) and supports for judgments (comments accompanying judgments which explain the rationale for a judgment) for random sequence generation of included RCTs from RoB tables of Cochrane reviews using automated data scraping. We categorised all supporting comments, analysed the number and type of various supporting comments and assessed adequacy of RoB judgment for randomisation in line with recommendations from the Cochrane Handbook. Results We analysed 10,103 RCTs that were included in 704 Cochrane reviews. For 5,706 RCTs, randomisation was not described, but for the remaining RCTs, it was indicated that randomisation was performed using computer/software/internet (N = 2,850), random number table (N = 883), mechanical method (N = 359) or it was incomplete/inappropriate (N = 305). Overall, 1,220/10,103 trials (12%) did not have a RoB judgment in line with Cochrane Handbook guidance about randomisation. The highest proportion of misjudgements was found for trials with high RoB (28%), followed by those with low (20%) or unclear (3%). Therefore, one in eight judgments for the analysed domain in Cochrane reviews was not in line with Cochrane Handbook, and one in four if the judgment was "high risk". Conclusion Authors of Cochrane reviews often make judgments about the RoB related to random sequence generation that are not in line with instructions given in the Cochrane Handbook, which compromises the reliability of the systematic reviews. Our results can help authors of both Cochrane and non-Cochrane reviews which use Cochrane RoB tool to avoid making common mistakes when assessing RoB in included trials.
topic Risk of bias
Cochrane
Systematic reviews
Randomisation
Sequence generation
Selection bias
url http://link.springer.com/article/10.1186/s12874-019-0804-y
work_keys_str_mv AT ognjenbarcot riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT matijaboric riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT tinapoklepovicpericic riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT marijacavar riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT svjetlanadosenovic riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT ivanavuka riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
AT liviapuljak riskofbiasjudgmentsforrandomsequencegenerationincochranesystematicreviewswerefrequentlynotinlinewithcochranehandbook
_version_ 1724659028190035968