Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method

(1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improv...

Full description

Bibliographic Details
Main Authors: Hai-Chao Li, Xin He, Shan-Peng Qiao, Zhen-Ni Liu, Yu-Zhou Gao
Format: Article
Language:English
Published: MDPI AG 2020-12-01
Series:Applied Sciences
Subjects:
Online Access:https://www.mdpi.com/2076-3417/10/23/8682
id doaj-54c7779ecf9141bbbfc10e24164116db
record_format Article
spelling doaj-54c7779ecf9141bbbfc10e24164116db2020-12-05T00:02:17ZengMDPI AGApplied Sciences2076-34172020-12-01108682868210.3390/app10238682Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling MethodHai-Chao Li0Xin He1Shan-Peng Qiao2Zhen-Ni Liu3Yu-Zhou Gao4Department of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Jilin City Institute of Biological Products, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Jilin 132013, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, China(1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improved coupling method were used to develop an N-terminal pro-B-type natriuretic peptide (NT-proBNP) diagnostic reagent. (2) Methods: The purification method of CmAP was improved and the related enzyme activities were assessed. The enzyme and magnetic beads were coupled only to the Fc region of the detection antibody and the capture antibody, respectively, by using a specially improved method. The NT-proBNP in human serum was assessed. (3) Results: The specific activity of the purified CmAP was found to be 13,133 U/mg. No loss in the enzyme activity was observed after its storage at room temperature for 4 months. The sensitivity of the in vitro diagnostic reagents was found to be 0.58 ng/L. (4) Conclusions: CmAP can be applied as a substitute for the commercial ALP. Analytical parameters indicated that the chemiluminescence diagnostic reagent for NT-proBNP is adequately sensitive and reliable for detecting the serum NT-proBNP, which suggests that both the enzyme and coupling method are suitable for the CLEIA.https://www.mdpi.com/2076-3417/10/23/8682chemiluminescence enzyme immunoassay (CLEIA)<i>Cobetia marina</i> alkaline phosphatase (CmAP)N-terminal prohormone of brain natriuretic peptide (NT-proBNP)antibody coupling
collection DOAJ
language English
format Article
sources DOAJ
author Hai-Chao Li
Xin He
Shan-Peng Qiao
Zhen-Ni Liu
Yu-Zhou Gao
spellingShingle Hai-Chao Li
Xin He
Shan-Peng Qiao
Zhen-Ni Liu
Yu-Zhou Gao
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
Applied Sciences
chemiluminescence enzyme immunoassay (CLEIA)
<i>Cobetia marina</i> alkaline phosphatase (CmAP)
N-terminal prohormone of brain natriuretic peptide (NT-proBNP)
antibody coupling
author_facet Hai-Chao Li
Xin He
Shan-Peng Qiao
Zhen-Ni Liu
Yu-Zhou Gao
author_sort Hai-Chao Li
title Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
title_short Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
title_full Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
title_fullStr Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
title_full_unstemmed Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
title_sort development of an nt-probnp assay reagent based on high specific activity alkaline phosphatase cmap and an improved coupling method
publisher MDPI AG
series Applied Sciences
issn 2076-3417
publishDate 2020-12-01
description (1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improved coupling method were used to develop an N-terminal pro-B-type natriuretic peptide (NT-proBNP) diagnostic reagent. (2) Methods: The purification method of CmAP was improved and the related enzyme activities were assessed. The enzyme and magnetic beads were coupled only to the Fc region of the detection antibody and the capture antibody, respectively, by using a specially improved method. The NT-proBNP in human serum was assessed. (3) Results: The specific activity of the purified CmAP was found to be 13,133 U/mg. No loss in the enzyme activity was observed after its storage at room temperature for 4 months. The sensitivity of the in vitro diagnostic reagents was found to be 0.58 ng/L. (4) Conclusions: CmAP can be applied as a substitute for the commercial ALP. Analytical parameters indicated that the chemiluminescence diagnostic reagent for NT-proBNP is adequately sensitive and reliable for detecting the serum NT-proBNP, which suggests that both the enzyme and coupling method are suitable for the CLEIA.
topic chemiluminescence enzyme immunoassay (CLEIA)
<i>Cobetia marina</i> alkaline phosphatase (CmAP)
N-terminal prohormone of brain natriuretic peptide (NT-proBNP)
antibody coupling
url https://www.mdpi.com/2076-3417/10/23/8682
work_keys_str_mv AT haichaoli developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod
AT xinhe developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod
AT shanpengqiao developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod
AT zhenniliu developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod
AT yuzhougao developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod
_version_ 1724400179396739072