Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method
(1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improv...
Main Authors: | , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2020-12-01
|
Series: | Applied Sciences |
Subjects: | |
Online Access: | https://www.mdpi.com/2076-3417/10/23/8682 |
id |
doaj-54c7779ecf9141bbbfc10e24164116db |
---|---|
record_format |
Article |
spelling |
doaj-54c7779ecf9141bbbfc10e24164116db2020-12-05T00:02:17ZengMDPI AGApplied Sciences2076-34172020-12-01108682868210.3390/app10238682Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling MethodHai-Chao Li0Xin He1Shan-Peng Qiao2Zhen-Ni Liu3Yu-Zhou Gao4Department of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Jilin City Institute of Biological Products, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Jilin 132013, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, ChinaDepartment of Changchun Institute of Engineering Technology, Suzhou Institute of Biomedical Engineering and Technology, Chinese Academy of Science (CAS), Changchun 130052, China(1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improved coupling method were used to develop an N-terminal pro-B-type natriuretic peptide (NT-proBNP) diagnostic reagent. (2) Methods: The purification method of CmAP was improved and the related enzyme activities were assessed. The enzyme and magnetic beads were coupled only to the Fc region of the detection antibody and the capture antibody, respectively, by using a specially improved method. The NT-proBNP in human serum was assessed. (3) Results: The specific activity of the purified CmAP was found to be 13,133 U/mg. No loss in the enzyme activity was observed after its storage at room temperature for 4 months. The sensitivity of the in vitro diagnostic reagents was found to be 0.58 ng/L. (4) Conclusions: CmAP can be applied as a substitute for the commercial ALP. Analytical parameters indicated that the chemiluminescence diagnostic reagent for NT-proBNP is adequately sensitive and reliable for detecting the serum NT-proBNP, which suggests that both the enzyme and coupling method are suitable for the CLEIA.https://www.mdpi.com/2076-3417/10/23/8682chemiluminescence enzyme immunoassay (CLEIA)<i>Cobetia marina</i> alkaline phosphatase (CmAP)N-terminal prohormone of brain natriuretic peptide (NT-proBNP)antibody coupling |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Hai-Chao Li Xin He Shan-Peng Qiao Zhen-Ni Liu Yu-Zhou Gao |
spellingShingle |
Hai-Chao Li Xin He Shan-Peng Qiao Zhen-Ni Liu Yu-Zhou Gao Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method Applied Sciences chemiluminescence enzyme immunoassay (CLEIA) <i>Cobetia marina</i> alkaline phosphatase (CmAP) N-terminal prohormone of brain natriuretic peptide (NT-proBNP) antibody coupling |
author_facet |
Hai-Chao Li Xin He Shan-Peng Qiao Zhen-Ni Liu Yu-Zhou Gao |
author_sort |
Hai-Chao Li |
title |
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method |
title_short |
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method |
title_full |
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method |
title_fullStr |
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method |
title_full_unstemmed |
Development of an NT-ProBNP Assay Reagent Based on High Specific Activity Alkaline Phosphatase CmAP and an Improved Coupling Method |
title_sort |
development of an nt-probnp assay reagent based on high specific activity alkaline phosphatase cmap and an improved coupling method |
publisher |
MDPI AG |
series |
Applied Sciences |
issn |
2076-3417 |
publishDate |
2020-12-01 |
description |
(1) Background: Chemiluminescent enzyme immunoassay (CLEIA) is an efficient analytical method. Alkaline phosphatase (ALP) with high specific activity is the basis for CLEIA to achieve high sensitivity. In this study, a high specific activity <i>Cobetia marina</i> ALP (CmAP) and an improved coupling method were used to develop an N-terminal pro-B-type natriuretic peptide (NT-proBNP) diagnostic reagent. (2) Methods: The purification method of CmAP was improved and the related enzyme activities were assessed. The enzyme and magnetic beads were coupled only to the Fc region of the detection antibody and the capture antibody, respectively, by using a specially improved method. The NT-proBNP in human serum was assessed. (3) Results: The specific activity of the purified CmAP was found to be 13,133 U/mg. No loss in the enzyme activity was observed after its storage at room temperature for 4 months. The sensitivity of the in vitro diagnostic reagents was found to be 0.58 ng/L. (4) Conclusions: CmAP can be applied as a substitute for the commercial ALP. Analytical parameters indicated that the chemiluminescence diagnostic reagent for NT-proBNP is adequately sensitive and reliable for detecting the serum NT-proBNP, which suggests that both the enzyme and coupling method are suitable for the CLEIA. |
topic |
chemiluminescence enzyme immunoassay (CLEIA) <i>Cobetia marina</i> alkaline phosphatase (CmAP) N-terminal prohormone of brain natriuretic peptide (NT-proBNP) antibody coupling |
url |
https://www.mdpi.com/2076-3417/10/23/8682 |
work_keys_str_mv |
AT haichaoli developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod AT xinhe developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod AT shanpengqiao developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod AT zhenniliu developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod AT yuzhougao developmentofanntprobnpassayreagentbasedonhighspecificactivityalkalinephosphatasecmapandanimprovedcouplingmethod |
_version_ |
1724400179396739072 |