Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds

<p>This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and...

Full description

Bibliographic Details
Main Authors: H. A. Fathy, E. M. Gouda, J. A. Gafer, M. K. Galal, A. M. Nowier
Format: Article
Language:English
Published: Copernicus Publications 2018-12-01
Series:Archives Animal Breeding
Online Access:https://www.arch-anim-breed.net/61/505/2018/aab-61-505-2018.pdf
id doaj-4f223b2edbf04956a426c0161f374efb
record_format Article
spelling doaj-4f223b2edbf04956a426c0161f374efb2020-11-25T02:21:31ZengCopernicus PublicationsArchives Animal Breeding0003-94382363-98222018-12-016150551610.5194/aab-61-505-2018Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breedsH. A. Fathy0E. M. Gouda1J. A. Gafer2M. K. Galal3A. M. Nowier4Biotechnology unit, Animal Reproduction Research Institute, Giza, EgyptDepartment of Biochemistry and Chemistry of Nutrition, Faculty of Veterinary Medicine, Cairo University, Giza, EgyptBiotechnology unit, Animal Reproduction Research Institute, Giza, EgyptDepartment of Biochemistry and Chemistry of Nutrition, Faculty of Veterinary Medicine, Cairo University, Giza, EgyptBiotechnology Research Department, Animal Production Research Institute, Dokki, Egypt<p>This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes.</p>https://www.arch-anim-breed.net/61/505/2018/aab-61-505-2018.pdf
collection DOAJ
language English
format Article
sources DOAJ
author H. A. Fathy
E. M. Gouda
J. A. Gafer
M. K. Galal
A. M. Nowier
spellingShingle H. A. Fathy
E. M. Gouda
J. A. Gafer
M. K. Galal
A. M. Nowier
Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
Archives Animal Breeding
author_facet H. A. Fathy
E. M. Gouda
J. A. Gafer
M. K. Galal
A. M. Nowier
author_sort H. A. Fathy
title Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_short Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_full Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_fullStr Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_full_unstemmed Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_sort genetic polymorphism in melatonin receptor 1a and arylalkylamine n-acetyltransferase and its impact on seasonal reproduction in egyptian sheep breeds
publisher Copernicus Publications
series Archives Animal Breeding
issn 0003-9438
2363-9822
publishDate 2018-12-01
description <p>This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes.</p>
url https://www.arch-anim-breed.net/61/505/2018/aab-61-505-2018.pdf
work_keys_str_mv AT hafathy geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT emgouda geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT jagafer geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT mkgalal geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT amnowier geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
_version_ 1724865534509449216