S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.

<h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein marker...

Full description

Bibliographic Details
Main Authors: Lisa Reinhard, Christian Rupp, Hans-Dieter Riedel, Thomas Ruppert, Thomas Giese, Christa Flechtenmacher, Karl Heinz Weiss, Petra Kloeters-Plachky, Wolfgang Stremmel, Peter Schirmacher, Peter Sauer, Daniel Nils Gotthardt
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2012-01-01
Series:PLoS ONE
Online Access:https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/22253789/pdf/?tool=EBI
id doaj-4c9a56774a794a25ad324c6ba31a69cb
record_format Article
spelling doaj-4c9a56774a794a25ad324c6ba31a69cb2021-03-04T01:10:52ZengPublic Library of Science (PLoS)PLoS ONE1932-62032012-01-0171e2982110.1371/journal.pone.0029821S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.Lisa ReinhardChristian RuppHans-Dieter RiedelThomas RuppertThomas GieseChrista FlechtenmacherKarl Heinz WeissPetra Kloeters-PlachkyWolfgang StremmelPeter SchirmacherPeter SauerDaniel Nils Gotthardt<h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach.<h4>Methods</h4>Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR.<h4>Results</h4>A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05).<h4>Conclusions</h4>The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation.https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/22253789/pdf/?tool=EBI
collection DOAJ
language English
format Article
sources DOAJ
author Lisa Reinhard
Christian Rupp
Hans-Dieter Riedel
Thomas Ruppert
Thomas Giese
Christa Flechtenmacher
Karl Heinz Weiss
Petra Kloeters-Plachky
Wolfgang Stremmel
Peter Schirmacher
Peter Sauer
Daniel Nils Gotthardt
spellingShingle Lisa Reinhard
Christian Rupp
Hans-Dieter Riedel
Thomas Ruppert
Thomas Giese
Christa Flechtenmacher
Karl Heinz Weiss
Petra Kloeters-Plachky
Wolfgang Stremmel
Peter Schirmacher
Peter Sauer
Daniel Nils Gotthardt
S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
PLoS ONE
author_facet Lisa Reinhard
Christian Rupp
Hans-Dieter Riedel
Thomas Ruppert
Thomas Giese
Christa Flechtenmacher
Karl Heinz Weiss
Petra Kloeters-Plachky
Wolfgang Stremmel
Peter Schirmacher
Peter Sauer
Daniel Nils Gotthardt
author_sort Lisa Reinhard
title S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_short S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_full S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_fullStr S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_full_unstemmed S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_sort s100a9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
publisher Public Library of Science (PLoS)
series PLoS ONE
issn 1932-6203
publishDate 2012-01-01
description <h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach.<h4>Methods</h4>Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR.<h4>Results</h4>A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05).<h4>Conclusions</h4>The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation.
url https://www.ncbi.nlm.nih.gov/pmc/articles/pmid/22253789/pdf/?tool=EBI
work_keys_str_mv AT lisareinhard s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT christianrupp s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT hansdieterriedel s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT thomasruppert s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT thomasgiese s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT christaflechtenmacher s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT karlheinzweiss s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT petrakloetersplachky s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT wolfgangstremmel s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT peterschirmacher s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT petersauer s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT danielnilsgotthardt s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
_version_ 1714809704976220160