C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways

<p>Abstract</p> <p>Background</p> <p>C-type natriuretic peptide (CNP) has recently been identified as an important anabolic regulator of endochondral bone growth, but the molecular mechanisms mediating its effects are not completely understood.</p> <p>Result...

Full description

Bibliographic Details
Main Authors: Serra Rosa, Stanton Lee-Anne, Gillespie J Ryan, James Claudine G, Khan Sameena, Agoston Hanga, Beier Frank
Format: Article
Language:English
Published: BMC 2007-03-01
Series:BMC Developmental Biology
Online Access:http://www.biomedcentral.com/1471-213X/7/18
id doaj-492267ca707a4ceb86c060087be601e0
record_format Article
spelling doaj-492267ca707a4ceb86c060087be601e02020-11-24T22:12:59ZengBMCBMC Developmental Biology1471-213X2007-03-01711810.1186/1471-213X-7-18C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathwaysSerra RosaStanton Lee-AnneGillespie J RyanJames Claudine GKhan SameenaAgoston HangaBeier Frank<p>Abstract</p> <p>Background</p> <p>C-type natriuretic peptide (CNP) has recently been identified as an important anabolic regulator of endochondral bone growth, but the molecular mechanisms mediating its effects are not completely understood.</p> <p>Results</p> <p>We demonstrate in a tibia organ culture system that pharmacological inhibition of p38 blocks the anabolic effects of CNP. We further show that CNP stimulates endochondral bone growth largely through expansion of the hypertrophic zone of the growth plate, while delaying mineralization. Both effects are reversed by p38 inhibition. We also performed Affymetrix microarray analyses on micro-dissected tibiae to identify CNP target genes. These studies confirmed that hypertrophic chondrocytes are the main targets of CNP signaling in the growth plate, since many more genes were regulated by CNP in this zone than in the others. While CNP receptors are expressed at similar levels in all three zones, cGMP-dependent kinases I and II, important transducers of CNP signaling, are expressed at much higher levels in hypertrophic cells than in other areas of the tibia, providing a potential explanation for the spatial distribution of CNP effects. In addition, our data show that CNP induces the expression of NPR3, a decoy receptor for natriuretic peptides, suggesting the existence of a feedback loop to limit CNP signaling. Finally, detailed analyses of our microarray data showed that CNP regulates numerous genes involved in BMP signaling and cell adhesion.</p> <p>Conclusion</p> <p>Our data identify novel target genes of CNP and demonstrate that the p38 pathway is a novel, essential mediator of CNP effects on endochondral bone growth, with potential implications for understanding and treatment of numerous skeletal diseases.</p> http://www.biomedcentral.com/1471-213X/7/18
collection DOAJ
language English
format Article
sources DOAJ
author Serra Rosa
Stanton Lee-Anne
Gillespie J Ryan
James Claudine G
Khan Sameena
Agoston Hanga
Beier Frank
spellingShingle Serra Rosa
Stanton Lee-Anne
Gillespie J Ryan
James Claudine G
Khan Sameena
Agoston Hanga
Beier Frank
C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
BMC Developmental Biology
author_facet Serra Rosa
Stanton Lee-Anne
Gillespie J Ryan
James Claudine G
Khan Sameena
Agoston Hanga
Beier Frank
author_sort Serra Rosa
title C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
title_short C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
title_full C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
title_fullStr C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
title_full_unstemmed C-type natriuretic peptide regulates endochondral bone growth through p38 MAP kinase-dependent and – independent pathways
title_sort c-type natriuretic peptide regulates endochondral bone growth through p38 map kinase-dependent and – independent pathways
publisher BMC
series BMC Developmental Biology
issn 1471-213X
publishDate 2007-03-01
description <p>Abstract</p> <p>Background</p> <p>C-type natriuretic peptide (CNP) has recently been identified as an important anabolic regulator of endochondral bone growth, but the molecular mechanisms mediating its effects are not completely understood.</p> <p>Results</p> <p>We demonstrate in a tibia organ culture system that pharmacological inhibition of p38 blocks the anabolic effects of CNP. We further show that CNP stimulates endochondral bone growth largely through expansion of the hypertrophic zone of the growth plate, while delaying mineralization. Both effects are reversed by p38 inhibition. We also performed Affymetrix microarray analyses on micro-dissected tibiae to identify CNP target genes. These studies confirmed that hypertrophic chondrocytes are the main targets of CNP signaling in the growth plate, since many more genes were regulated by CNP in this zone than in the others. While CNP receptors are expressed at similar levels in all three zones, cGMP-dependent kinases I and II, important transducers of CNP signaling, are expressed at much higher levels in hypertrophic cells than in other areas of the tibia, providing a potential explanation for the spatial distribution of CNP effects. In addition, our data show that CNP induces the expression of NPR3, a decoy receptor for natriuretic peptides, suggesting the existence of a feedback loop to limit CNP signaling. Finally, detailed analyses of our microarray data showed that CNP regulates numerous genes involved in BMP signaling and cell adhesion.</p> <p>Conclusion</p> <p>Our data identify novel target genes of CNP and demonstrate that the p38 pathway is a novel, essential mediator of CNP effects on endochondral bone growth, with potential implications for understanding and treatment of numerous skeletal diseases.</p>
url http://www.biomedcentral.com/1471-213X/7/18
work_keys_str_mv AT serrarosa ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT stantonleeanne ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT gillespiejryan ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT jamesclaudineg ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT khansameena ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT agostonhanga ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
AT beierfrank ctypenatriureticpeptideregulatesendochondralbonegrowththroughp38mapkinasedependentandindependentpathways
_version_ 1725801657124519936