Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients

Background: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with...

Full description

Bibliographic Details
Main Authors: Hala Abdalazeem Aljack, Mohammed Karrar Abdalla, Omer Fadl Idris, Amar Mohamed Ismail
Format: Article
Language:English
Published: Wolters Kluwer Medknow Publications 2019-01-01
Series:Journal of Research in Medical Sciences
Subjects:
Online Access:http://www.jmsjournal.net/article.asp?issn=1735-1995;year=2019;volume=24;issue=1;spage=47;epage=47;aulast=Aljack
id doaj-3e7a086531d14d5487f0533cc347c24e
record_format Article
spelling doaj-3e7a086531d14d5487f0533cc347c24e2020-11-25T02:04:56ZengWolters Kluwer Medknow PublicationsJournal of Research in Medical Sciences1735-19951735-71362019-01-01241474710.4103/jrms.JRMS_303_18Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patientsHala Abdalazeem AljackMohammed Karrar AbdallaOmer Fadl IdrisAmar Mohamed IsmailBackground: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with diabetic nephropathy and cardiovascular diseases (CVD). Materials and Methods: In this cross-sectional study, 205 patients with Type 2 diabetes age ranged from 39 to 75 years old were enrolled. Serum VD, high-sensitivity C-reactive protein (hs-CRP), and hemoglobin A1c (HbA1c) were measured. In addition, urinary albumin:creatinine ratio (ACR) was estimated. Results: Patients with Type 2 diabetes had a 78.5% VD level <30 ng/m. ACR and hs-CRP levels were significantly increased in patients with diabetes with VD <30 ng/m (P = 0.011 and P = 0.008, respectively). Female had significantly lower VD level than male P < 0.001. Patients exposed to sunlight had significantly higher VD level and lower hs-CRP levels compared with less-exposed, P value (0.001 and <0.001), respectively. Exercise significantly increased VD and decreased ACR levels in DM patients, P value (0.046 and 0.002), respectively. VD was positively associated with age (r = 0.355 P = 0.040) and negatively correlate with BMI (r = −0.502 P = 0.009), duration of disease (r = −0.498 P = 0.003), ACR (r = −0.384 P = 0.015), and HbA1c (r = −0.327 P = 0.032). Conclusion: The evidence from this study suggest that patients with Type 2 diabetes with VD deficiency are at higher risk for developing CVD and nephropathy.http://www.jmsjournal.net/article.asp?issn=1735-1995;year=2019;volume=24;issue=1;spage=47;epage=47;aulast=Aljackalbumin:creatinine ratiocardiovascular diseaseshigh-sensitivity c-reactive proteinnephropathysudantype 2 diabetes mellitusvitamin d
collection DOAJ
language English
format Article
sources DOAJ
author Hala Abdalazeem Aljack
Mohammed Karrar Abdalla
Omer Fadl Idris
Amar Mohamed Ismail
spellingShingle Hala Abdalazeem Aljack
Mohammed Karrar Abdalla
Omer Fadl Idris
Amar Mohamed Ismail
Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
Journal of Research in Medical Sciences
albumin:creatinine ratio
cardiovascular diseases
high-sensitivity c-reactive protein
nephropathy
sudan
type 2 diabetes mellitus
vitamin d
author_facet Hala Abdalazeem Aljack
Mohammed Karrar Abdalla
Omer Fadl Idris
Amar Mohamed Ismail
author_sort Hala Abdalazeem Aljack
title Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
title_short Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
title_full Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
title_fullStr Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
title_full_unstemmed Vitamin D deficiency increases risk of nephropathy and cardiovascular diseases in Type 2 diabetes mellitus patients
title_sort vitamin d deficiency increases risk of nephropathy and cardiovascular diseases in type 2 diabetes mellitus patients
publisher Wolters Kluwer Medknow Publications
series Journal of Research in Medical Sciences
issn 1735-1995
1735-7136
publishDate 2019-01-01
description Background: Vitamin D (VD) deficiency is associated with insulin function and secretion. It is linked with diabetes mellitus (DM) progression, and complications were also recorded. Therefore, the current study aimed to investigate serum VD level in Type 2 DM (T2DM) patients and its association with diabetic nephropathy and cardiovascular diseases (CVD). Materials and Methods: In this cross-sectional study, 205 patients with Type 2 diabetes age ranged from 39 to 75 years old were enrolled. Serum VD, high-sensitivity C-reactive protein (hs-CRP), and hemoglobin A1c (HbA1c) were measured. In addition, urinary albumin:creatinine ratio (ACR) was estimated. Results: Patients with Type 2 diabetes had a 78.5% VD level <30 ng/m. ACR and hs-CRP levels were significantly increased in patients with diabetes with VD <30 ng/m (P = 0.011 and P = 0.008, respectively). Female had significantly lower VD level than male P < 0.001. Patients exposed to sunlight had significantly higher VD level and lower hs-CRP levels compared with less-exposed, P value (0.001 and <0.001), respectively. Exercise significantly increased VD and decreased ACR levels in DM patients, P value (0.046 and 0.002), respectively. VD was positively associated with age (r = 0.355 P = 0.040) and negatively correlate with BMI (r = −0.502 P = 0.009), duration of disease (r = −0.498 P = 0.003), ACR (r = −0.384 P = 0.015), and HbA1c (r = −0.327 P = 0.032). Conclusion: The evidence from this study suggest that patients with Type 2 diabetes with VD deficiency are at higher risk for developing CVD and nephropathy.
topic albumin:creatinine ratio
cardiovascular diseases
high-sensitivity c-reactive protein
nephropathy
sudan
type 2 diabetes mellitus
vitamin d
url http://www.jmsjournal.net/article.asp?issn=1735-1995;year=2019;volume=24;issue=1;spage=47;epage=47;aulast=Aljack
work_keys_str_mv AT halaabdalazeemaljack vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients
AT mohammedkarrarabdalla vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients
AT omerfadlidris vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients
AT amarmohamedismail vitaminddeficiencyincreasesriskofnephropathyandcardiovasculardiseasesintype2diabetesmellituspatients
_version_ 1724940168258912256