The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages

African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency...

Full description

Bibliographic Details
Main Authors: Taehwan Oh, Duy Tien Do, Hung Van Vo, Hyeok-il Kwon, Seung-Chul Lee, Min Ho Kim, Dung Thi Thu Nguyen, Quang Tin Vinh Le, Tan Minh Tran, Toan Tat Nguyen, Joo Young Lee, Chanhee Chae
Format: Article
Language:English
Published: Frontiers Media S.A. 2021-03-01
Series:Frontiers in Veterinary Science
Subjects:
Online Access:https://www.frontiersin.org/articles/10.3389/fvets.2021.645456/full
id doaj-38b2636183d24f438972622f78ac4dfb
record_format Article
spelling doaj-38b2636183d24f438972622f78ac4dfb2021-03-19T05:28:49ZengFrontiers Media S.A.Frontiers in Veterinary Science2297-17692021-03-01810.3389/fvets.2021.645456645456The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine MacrophagesTaehwan Oh0Duy Tien Do1Hung Van Vo2Hyeok-il Kwon3Seung-Chul Lee4Min Ho Kim5Dung Thi Thu Nguyen6Quang Tin Vinh Le7Tan Minh Tran8Toan Tat Nguyen9Joo Young Lee10Chanhee Chae11Department of Veterinary Pathology, College of Veterinary Medicine, Seoul National University, Seoul, South KoreaFaculty of Animal Sciences and Veterinary Medicine, Nong Lam University, Ho Chi Minh City, VietnamDepartment of Animal Health, Center for Veterinary Diagnostics, Regional Animal Health Office No. 6, Ho Chi Minh City, VietnamChoongAng Vaccine Laboratories, Daejeon, South KoreaChoongAng Vaccine Laboratories, Daejeon, South KoreaChoongAng Vaccine Laboratories, Daejeon, South KoreaFaculty of Animal Sciences and Veterinary Medicine, Nong Lam University, Ho Chi Minh City, VietnamDepartment of Animal Health, Center for Veterinary Diagnostics, Regional Animal Health Office No. 6, Ho Chi Minh City, VietnamDepartment of Animal Health, Center for Veterinary Diagnostics, Regional Animal Health Office No. 6, Ho Chi Minh City, VietnamFaculty of Animal Sciences and Veterinary Medicine, Nong Lam University, Ho Chi Minh City, VietnamChoongAng Vaccine Laboratories, Daejeon, South KoreaDepartment of Veterinary Pathology, College of Veterinary Medicine, Seoul National University, Seoul, South KoreaAfrican swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production.https://www.frontiersin.org/articles/10.3389/fvets.2021.645456/fullvirus replicationvirus isolationAfrican swine fevermolecular chacterizationrenal-derived macrophages
collection DOAJ
language English
format Article
sources DOAJ
author Taehwan Oh
Duy Tien Do
Hung Van Vo
Hyeok-il Kwon
Seung-Chul Lee
Min Ho Kim
Dung Thi Thu Nguyen
Quang Tin Vinh Le
Tan Minh Tran
Toan Tat Nguyen
Joo Young Lee
Chanhee Chae
spellingShingle Taehwan Oh
Duy Tien Do
Hung Van Vo
Hyeok-il Kwon
Seung-Chul Lee
Min Ho Kim
Dung Thi Thu Nguyen
Quang Tin Vinh Le
Tan Minh Tran
Toan Tat Nguyen
Joo Young Lee
Chanhee Chae
The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
Frontiers in Veterinary Science
virus replication
virus isolation
African swine fever
molecular chacterization
renal-derived macrophages
author_facet Taehwan Oh
Duy Tien Do
Hung Van Vo
Hyeok-il Kwon
Seung-Chul Lee
Min Ho Kim
Dung Thi Thu Nguyen
Quang Tin Vinh Le
Tan Minh Tran
Toan Tat Nguyen
Joo Young Lee
Chanhee Chae
author_sort Taehwan Oh
title The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_short The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_full The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_fullStr The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_full_unstemmed The Isolation and Replication of African Swine Fever Virus in Primary Renal-Derived Swine Macrophages
title_sort isolation and replication of african swine fever virus in primary renal-derived swine macrophages
publisher Frontiers Media S.A.
series Frontiers in Veterinary Science
issn 2297-1769
publishDate 2021-03-01
description African swine fever virus (ASFV) causes hemorrhagic disease in domestic pigs by replicating mainly in monocyte/macrophage lineages. Various primary cells including pulmonary alveolar macrophages have been used for the propagation of ASFV on this account. However, ethical constraints and consistency problems exist as it is necessary to harvest same phenotype of primary cells in order to continue a study. We suggested renal-derived swine macrophages as a novel primary cell candidate to address these issues. These primary cells proved to be permissive to both cell adapted ASFV and a wild-type ASFV. Compared to the commercial cell line MA-104, the renal-derived macrophages were more suitable to isolate the field virus. The consistent molecular characteristics of the renal-derived macrophages were demonstrated by immunocytochemistry with antibodies against macrophage cell surface markers including CD163, CD172a, and Iba-1. Viral protein p30 and p72 expression in ASFV infected macrophages was confirmed by immunocytochemistry by use of specific monoclonal antibodies. We observed increase of cell-free viral DNA and infectious virus titer in infected cell supernatant in successive days-post-infection. These results demonstrated that primary renal-derived swine macrophages are useful for ASFV isolation and propagation in terms of cell phenotypes, susceptibility to the virus, and virus production.
topic virus replication
virus isolation
African swine fever
molecular chacterization
renal-derived macrophages
url https://www.frontiersin.org/articles/10.3389/fvets.2021.645456/full
work_keys_str_mv AT taehwanoh theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT duytiendo theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT hungvanvo theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT hyeokilkwon theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT seungchullee theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT minhokim theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT dungthithunguyen theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT quangtinvinhle theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT tanminhtran theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT toantatnguyen theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT jooyounglee theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT chanheechae theisolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT taehwanoh isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT duytiendo isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT hungvanvo isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT hyeokilkwon isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT seungchullee isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT minhokim isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT dungthithunguyen isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT quangtinvinhle isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT tanminhtran isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT toantatnguyen isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT jooyounglee isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
AT chanheechae isolationandreplicationofafricanswinefevervirusinprimaryrenalderivedswinemacrophages
_version_ 1724214587466711040