Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes
Functional foods containing peptides offer the possibility to modulate the absorption of sugars and insulin levels to prevent diabetes. This study investigates the potential of germinated soybean peptides to modulate postprandial glycaemic response through inhibition of dipeptidyl peptidase IV (DPP-...
Main Authors: | , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2018-09-01
|
Series: | International Journal of Molecular Sciences |
Subjects: | |
Online Access: | http://www.mdpi.com/1422-0067/19/10/2883 |
id |
doaj-30c9479f9e3d4ca48e4808181ac5054f |
---|---|
record_format |
Article |
spelling |
doaj-30c9479f9e3d4ca48e4808181ac5054f2020-11-24T21:48:27ZengMDPI AGInternational Journal of Molecular Sciences1422-00672018-09-011910288310.3390/ijms19102883ijms19102883Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase EnzymesMarcela González-Montoya0Blanca Hernández-Ledesma1Rosalva Mora-Escobedo2Cristina Martínez-Villaluenga3Escuela Nacional de Ciencias Biológicas-Instituto Politécnico Nacional. Campus Zacatenco, Unidad Profesional “Adolfo López Mateos”, Calle Wilfrido Massieu esquina Cda. Manuel Stampa. C.P, Ciudad de México 07738, MexicoInstituto de Investigación en Ciencias de la Alimentación (CIAL, CSIC-UAM, CEI UAM+CSIC), Nicolás Cabrera 9, 28049 Madrid, SpainEscuela Nacional de Ciencias Biológicas-Instituto Politécnico Nacional. Campus Zacatenco, Unidad Profesional “Adolfo López Mateos”, Calle Wilfrido Massieu esquina Cda. Manuel Stampa. C.P, Ciudad de México 07738, MexicoInstitute of Food Science, Technology and Nutrition (ICTAN-CSIC), Juan de la Cierva 3, 28006 Madrid, SpainFunctional foods containing peptides offer the possibility to modulate the absorption of sugars and insulin levels to prevent diabetes. This study investigates the potential of germinated soybean peptides to modulate postprandial glycaemic response through inhibition of dipeptidyl peptidase IV (DPP-IV), salivary α-amylase, and intestinal α-glucosidases. A protein isolate from soybean sprouts was digested by pepsin and pancreatin. Protein digest and peptide fractions obtained by ultrafiltration (<5, 5–10 and >10 kDa) and subsequent semipreparative reverse phase liquid chromatography (F1, F2, F3, and F4) were screened for in vitro inhibition of DPP-IV, α-amylase, maltase, and sucrase activities. Protein digest inhibited DPP-IV (IC50 = 1.49 mg/mL), α-amylase (IC50 = 1.70 mg/mL), maltase, and sucrase activities of α-glucosidases (IC50 = 3.73 and 2.90 mg/mL, respectively). Peptides of 5–10 and >10 kDa were more effective at inhibiting DPP-IV (IC50 = 0.91 and 1.18 mg/mL, respectively), while peptides of 5–10 and <5 kDa showed a higher potency to inhibit α-amylase and α-glucosidases. Peptides in F1, F2, and F3 were mainly fragments from β-conglycinin, glycinin, and P34 thiol protease. The analysis of structural features of peptides in F1–F3 allowed the tentative identification of potential antidiabetic peptides. Germinated soybean protein showed a promising potential to be used as a nutraceutical or functional ingredient for diabetes prevention.http://www.mdpi.com/1422-0067/19/10/2883germinated soybeangastrointestinal digestionpeptidesinhibitorsdipeptidyl peptidaseα-amylaseα-glucosidase |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Marcela González-Montoya Blanca Hernández-Ledesma Rosalva Mora-Escobedo Cristina Martínez-Villaluenga |
spellingShingle |
Marcela González-Montoya Blanca Hernández-Ledesma Rosalva Mora-Escobedo Cristina Martínez-Villaluenga Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes International Journal of Molecular Sciences germinated soybean gastrointestinal digestion peptides inhibitors dipeptidyl peptidase α-amylase α-glucosidase |
author_facet |
Marcela González-Montoya Blanca Hernández-Ledesma Rosalva Mora-Escobedo Cristina Martínez-Villaluenga |
author_sort |
Marcela González-Montoya |
title |
Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes |
title_short |
Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes |
title_full |
Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes |
title_fullStr |
Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes |
title_full_unstemmed |
Bioactive Peptides from Germinated Soybean with Anti-Diabetic Potential by Inhibition of Dipeptidyl Peptidase-IV, α-Amylase, and α-Glucosidase Enzymes |
title_sort |
bioactive peptides from germinated soybean with anti-diabetic potential by inhibition of dipeptidyl peptidase-iv, α-amylase, and α-glucosidase enzymes |
publisher |
MDPI AG |
series |
International Journal of Molecular Sciences |
issn |
1422-0067 |
publishDate |
2018-09-01 |
description |
Functional foods containing peptides offer the possibility to modulate the absorption of sugars and insulin levels to prevent diabetes. This study investigates the potential of germinated soybean peptides to modulate postprandial glycaemic response through inhibition of dipeptidyl peptidase IV (DPP-IV), salivary α-amylase, and intestinal α-glucosidases. A protein isolate from soybean sprouts was digested by pepsin and pancreatin. Protein digest and peptide fractions obtained by ultrafiltration (<5, 5–10 and >10 kDa) and subsequent semipreparative reverse phase liquid chromatography (F1, F2, F3, and F4) were screened for in vitro inhibition of DPP-IV, α-amylase, maltase, and sucrase activities. Protein digest inhibited DPP-IV (IC50 = 1.49 mg/mL), α-amylase (IC50 = 1.70 mg/mL), maltase, and sucrase activities of α-glucosidases (IC50 = 3.73 and 2.90 mg/mL, respectively). Peptides of 5–10 and >10 kDa were more effective at inhibiting DPP-IV (IC50 = 0.91 and 1.18 mg/mL, respectively), while peptides of 5–10 and <5 kDa showed a higher potency to inhibit α-amylase and α-glucosidases. Peptides in F1, F2, and F3 were mainly fragments from β-conglycinin, glycinin, and P34 thiol protease. The analysis of structural features of peptides in F1–F3 allowed the tentative identification of potential antidiabetic peptides. Germinated soybean protein showed a promising potential to be used as a nutraceutical or functional ingredient for diabetes prevention. |
topic |
germinated soybean gastrointestinal digestion peptides inhibitors dipeptidyl peptidase α-amylase α-glucosidase |
url |
http://www.mdpi.com/1422-0067/19/10/2883 |
work_keys_str_mv |
AT marcelagonzalezmontoya bioactivepeptidesfromgerminatedsoybeanwithantidiabeticpotentialbyinhibitionofdipeptidylpeptidaseivaamylaseandaglucosidaseenzymes AT blancahernandezledesma bioactivepeptidesfromgerminatedsoybeanwithantidiabeticpotentialbyinhibitionofdipeptidylpeptidaseivaamylaseandaglucosidaseenzymes AT rosalvamoraescobedo bioactivepeptidesfromgerminatedsoybeanwithantidiabeticpotentialbyinhibitionofdipeptidylpeptidaseivaamylaseandaglucosidaseenzymes AT cristinamartinezvillaluenga bioactivepeptidesfromgerminatedsoybeanwithantidiabeticpotentialbyinhibitionofdipeptidylpeptidaseivaamylaseandaglucosidaseenzymes |
_version_ |
1725892067451731968 |