The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells

Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone wit...

Full description

Bibliographic Details
Main Authors: Adrienne Bolden, Lynikka Bernard, Danielle Jones, Tunde Akinyeke, LaMonica V. Stewart
Format: Article
Language:English
Published: Hindawi Limited 2012-01-01
Series:PPAR Research
Online Access:http://dx.doi.org/10.1155/2012/929052
id doaj-2fcd54810502460bbfb52ba44e109896
record_format Article
spelling doaj-2fcd54810502460bbfb52ba44e1098962020-11-24T22:03:03ZengHindawi LimitedPPAR Research1687-47571687-47652012-01-01201210.1155/2012/929052929052The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer CellsAdrienne Bolden0Lynikka Bernard1Danielle Jones2Tunde Akinyeke3LaMonica V. Stewart4Department of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USAThiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone.http://dx.doi.org/10.1155/2012/929052
collection DOAJ
language English
format Article
sources DOAJ
author Adrienne Bolden
Lynikka Bernard
Danielle Jones
Tunde Akinyeke
LaMonica V. Stewart
spellingShingle Adrienne Bolden
Lynikka Bernard
Danielle Jones
Tunde Akinyeke
LaMonica V. Stewart
The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
PPAR Research
author_facet Adrienne Bolden
Lynikka Bernard
Danielle Jones
Tunde Akinyeke
LaMonica V. Stewart
author_sort Adrienne Bolden
title The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_short The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_full The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_fullStr The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_full_unstemmed The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_sort ppar gamma agonist troglitazone regulates erk 1/2 phosphorylation via a pparγ-independent, mek-dependent pathway in human prostate cancer cells
publisher Hindawi Limited
series PPAR Research
issn 1687-4757
1687-4765
publishDate 2012-01-01
description Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone.
url http://dx.doi.org/10.1155/2012/929052
work_keys_str_mv AT adriennebolden theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT lynikkabernard theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT daniellejones theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT tundeakinyeke theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT lamonicavstewart theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT adriennebolden ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT lynikkabernard ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT daniellejones ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT tundeakinyeke ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT lamonicavstewart ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
_version_ 1725833463890706432