Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)

Two new dasycladalean species from the Upper Cretaceous of the Mountain Paštrik, Kukes Cretaceous Unit of the Mirdita Zone are described: Trinocladus divnae sp. nov. is characterized by variable size of the thallus, relatively narrow main axis, typical Trinocladus organization of the laterals and th...

Full description

Bibliographic Details
Main Author: Radoičić Rajka
Format: Article
Language:English
Published: Faculty of Mining and Geology, Belgrade 2006-01-01
Series:Geološki Anali Balkanskoga Poluostrva
Subjects:
Online Access:http://www.doiserbia.nb.rs/img/doi/0350-0608/2006/0350-06080667065R.pdf
id doaj-28c50c6de0394d1e8500653671694a3b
record_format Article
spelling doaj-28c50c6de0394d1e8500653671694a3b2020-11-24T22:20:31ZengFaculty of Mining and Geology, BelgradeGeološki Anali Balkanskoga Poluostrva0350-06082406-07472006-01-01200667658710.2298/GABP0667065R0350-06080667065RTrinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)Radoičić Rajka0nemaTwo new dasycladalean species from the Upper Cretaceous of the Mountain Paštrik, Kukes Cretaceous Unit of the Mirdita Zone are described: Trinocladus divnae sp. nov. is characterized by variable size of the thallus, relatively narrow main axis, typical Trinocladus organization of the laterals and thin calcification limited to the distal part of the thallus which includes a swollen part of secondaries and short tertiaries. Often, the internal portion of the whorls (except sometimes the main stem membrane), tends to dissolve and form dissolution cavities filled with cement. Montiella filipovici sp. nov. is characterized by a primary skeleton made of a thin individual sheath around a fertile ampullae, often obliterated by recrystallization. Four to six laterals, each giving one secondary and one fertile ampulla located on the upper side of the relatively thick short primary lateral. Upper Cenomanian limestone with Cisalveolina fraasi and Trinocladus divnae sp. nov. was deposited immediately before the events that resulted in sea level rising. The middle and upper Cenomanian eustatic-tectonic processes had different effects in the Paštrik shallow water areas, depending on the distance from the basinal part of the Unit. Bathymetric changes in a part of the Paštrik sedimentary area were not significant, even negligible. Montiella filipovici is found in the post-fraasi shallow water sequence, assigned to the ?uppermost Cenomanian-lowermost Turonian (= Whiteinella archaeocretacea Zone p. p.; a short stratigraphic gap, in a part of the area, is noted). Shallow water limestone with Turonian taxa, corresponding to the helvetca Zone, occurs a few meters upward. Supplementary note: the species Cylindroporella parva RADOIČIĆ is transferred in the genus Montiella, the species Permocalculus elliotti JOHNSON is transferred in the genus Trinocladus, while the species Trinocladus bellus YU JING is transferred in the genus Belzungia.http://www.doiserbia.nb.rs/img/doi/0350-0608/2006/0350-06080667065R.pdfDasycladalesnew speciesnew combinationCenomanianTuronianMountain PaštrikKukes Cretaceous UnitMirdita Zone
collection DOAJ
language English
format Article
sources DOAJ
author Radoičić Rajka
spellingShingle Radoičić Rajka
Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
Geološki Anali Balkanskoga Poluostrva
Dasycladales
new species
new combination
Cenomanian
Turonian
Mountain Paštrik
Kukes Cretaceous Unit
Mirdita Zone
author_facet Radoičić Rajka
author_sort Radoičić Rajka
title Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
title_short Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
title_full Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
title_fullStr Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
title_full_unstemmed Trinocladus divnae and montiella filipovici: A new species (Dasycladales, green algae) from the Upper Cretaceous of the Mountain Paštrik (Mirdita Zone)
title_sort trinocladus divnae and montiella filipovici: a new species (dasycladales, green algae) from the upper cretaceous of the mountain paštrik (mirdita zone)
publisher Faculty of Mining and Geology, Belgrade
series Geološki Anali Balkanskoga Poluostrva
issn 0350-0608
2406-0747
publishDate 2006-01-01
description Two new dasycladalean species from the Upper Cretaceous of the Mountain Paštrik, Kukes Cretaceous Unit of the Mirdita Zone are described: Trinocladus divnae sp. nov. is characterized by variable size of the thallus, relatively narrow main axis, typical Trinocladus organization of the laterals and thin calcification limited to the distal part of the thallus which includes a swollen part of secondaries and short tertiaries. Often, the internal portion of the whorls (except sometimes the main stem membrane), tends to dissolve and form dissolution cavities filled with cement. Montiella filipovici sp. nov. is characterized by a primary skeleton made of a thin individual sheath around a fertile ampullae, often obliterated by recrystallization. Four to six laterals, each giving one secondary and one fertile ampulla located on the upper side of the relatively thick short primary lateral. Upper Cenomanian limestone with Cisalveolina fraasi and Trinocladus divnae sp. nov. was deposited immediately before the events that resulted in sea level rising. The middle and upper Cenomanian eustatic-tectonic processes had different effects in the Paštrik shallow water areas, depending on the distance from the basinal part of the Unit. Bathymetric changes in a part of the Paštrik sedimentary area were not significant, even negligible. Montiella filipovici is found in the post-fraasi shallow water sequence, assigned to the ?uppermost Cenomanian-lowermost Turonian (= Whiteinella archaeocretacea Zone p. p.; a short stratigraphic gap, in a part of the area, is noted). Shallow water limestone with Turonian taxa, corresponding to the helvetca Zone, occurs a few meters upward. Supplementary note: the species Cylindroporella parva RADOIČIĆ is transferred in the genus Montiella, the species Permocalculus elliotti JOHNSON is transferred in the genus Trinocladus, while the species Trinocladus bellus YU JING is transferred in the genus Belzungia.
topic Dasycladales
new species
new combination
Cenomanian
Turonian
Mountain Paštrik
Kukes Cretaceous Unit
Mirdita Zone
url http://www.doiserbia.nb.rs/img/doi/0350-0608/2006/0350-06080667065R.pdf
work_keys_str_mv AT radoicicrajka trinocladusdivnaeandmontiellafilipovicianewspeciesdasycladalesgreenalgaefromtheuppercretaceousofthemountainpastrikmirditazone
_version_ 1725774764373442560