The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis
Electrical myotonia is known to occur in a number of inherited and acquired disorders including myotonic dystrophies, channelopathies, and metabolic, toxic, and inflammatory myopathies. Yet, electrical myotonia in myasthenia gravis associated with antibodies against muscle-specific tyrosine kinase (...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Hindawi Limited
2015-01-01
|
Series: | Case Reports in Neurological Medicine |
Online Access: | http://dx.doi.org/10.1155/2015/242691 |
id |
doaj-1f7281c1b26145d9900c605cd51a0114 |
---|---|
record_format |
Article |
spelling |
doaj-1f7281c1b26145d9900c605cd51a01142020-11-24T21:17:58ZengHindawi LimitedCase Reports in Neurological Medicine2090-66682090-66762015-01-01201510.1155/2015/242691242691The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia GravisMarcus Magnussen0Ioannis Karakis1Taylor B. Harrison2Department of Neurology, Emory University, Atlanta, GA 30329, USADepartment of Neurology, Emory University, Atlanta, GA 30329, USADepartment of Neurology, Emory University, Atlanta, GA 30329, USAElectrical myotonia is known to occur in a number of inherited and acquired disorders including myotonic dystrophies, channelopathies, and metabolic, toxic, and inflammatory myopathies. Yet, electrical myotonia in myasthenia gravis associated with antibodies against muscle-specific tyrosine kinase (MuSK) has not been previously reported. We describe two such patients, both of whom had a typical presentation of proximal muscle weakness with respiratory failure in the context of a significant electrodecrement in repetitive nerve stimulation. In both cases, concentric needle examination revealed electrical myotonia combined with myopathic motor unit morphology and early recruitment. These findings suggest that MuSK myasthenia should be included within the differential diagnosis of disorders with electrical myotonia.http://dx.doi.org/10.1155/2015/242691 |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Marcus Magnussen Ioannis Karakis Taylor B. Harrison |
spellingShingle |
Marcus Magnussen Ioannis Karakis Taylor B. Harrison The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis Case Reports in Neurological Medicine |
author_facet |
Marcus Magnussen Ioannis Karakis Taylor B. Harrison |
author_sort |
Marcus Magnussen |
title |
The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis |
title_short |
The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis |
title_full |
The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis |
title_fullStr |
The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis |
title_full_unstemmed |
The Myotonic Plot Thickens: Electrical Myotonia in Antimuscle-Specific Kinase Myasthenia Gravis |
title_sort |
myotonic plot thickens: electrical myotonia in antimuscle-specific kinase myasthenia gravis |
publisher |
Hindawi Limited |
series |
Case Reports in Neurological Medicine |
issn |
2090-6668 2090-6676 |
publishDate |
2015-01-01 |
description |
Electrical myotonia is known to occur in a number of inherited and acquired disorders including myotonic dystrophies, channelopathies, and metabolic, toxic, and inflammatory myopathies. Yet, electrical myotonia in myasthenia gravis associated with antibodies against muscle-specific tyrosine kinase (MuSK) has not been previously reported. We describe two such patients, both of whom had a typical presentation of proximal muscle weakness with respiratory failure in the context of a significant electrodecrement in repetitive nerve stimulation. In both cases, concentric needle examination revealed electrical myotonia combined with myopathic motor unit morphology and early recruitment. These findings suggest that MuSK myasthenia should be included within the differential diagnosis of disorders with electrical myotonia. |
url |
http://dx.doi.org/10.1155/2015/242691 |
work_keys_str_mv |
AT marcusmagnussen themyotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis AT ioanniskarakis themyotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis AT taylorbharrison themyotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis AT marcusmagnussen myotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis AT ioanniskarakis myotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis AT taylorbharrison myotonicplotthickenselectricalmyotoniainantimusclespecifickinasemyastheniagravis |
_version_ |
1726011116094488576 |