Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study)
<p>Abstract</p> <p>Background</p> <p>No previous studies have compared the DPP-4 inhibitors vildagliptin and sitagliptin in terms of blood glucose levels using continuous glucose monitoring (CGM) and cardiovascular parameters.</p> <p>Methods</p> <p&...
Main Authors: | , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
BMC
2012-08-01
|
Series: | Cardiovascular Diabetology |
Subjects: | |
Online Access: | http://www.cardiab.com/content/11/1/92 |
id |
doaj-1e57820f283e4697865d49a0eae4bf06 |
---|---|
record_format |
Article |
spelling |
doaj-1e57820f283e4697865d49a0eae4bf062020-11-24T21:12:37ZengBMCCardiovascular Diabetology1475-28402012-08-011119210.1186/1475-2840-11-92Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study)Sakamoto MasayaNishimura RimeiIrako TaigaTsujino DaisukeAndo KiyotakaUtsunomiya Kazunori<p>Abstract</p> <p>Background</p> <p>No previous studies have compared the DPP-4 inhibitors vildagliptin and sitagliptin in terms of blood glucose levels using continuous glucose monitoring (CGM) and cardiovascular parameters.</p> <p>Methods</p> <p>Twenty patients with type 2 diabetes mellitus were randomly allocated to groups who received vildagliptin then sitagliptin, or vice versa. Patients were hospitalized at 1 month after starting each drug, and CGM was used to determine: 1) mean (± standard deviation) 24-hour blood glucose level, 2) mean amplitude of glycemic excursions (MAGE), 3) fasting blood glucose level, 4) highest postprandial blood glucose level and time, 5) increase in blood glucose level after each meal, 6) area under the curve (AUC) for blood glucose level ≥180 mg/dL within 3 hours after each meal, and 7) area over the curve (AOC) for daily blood glucose level <70 mg/dL. Plasma glycosylated hemoglobin (HbA1c), glycoalbumin (GA), 1,5-anhydroglucitol (1,5AG), immunoreactive insulin (IRI), C-peptide immunoreactivity (CPR), brain natriuretic peptide (BNP), and plasminogen activator inhibitor-1 (PAI-1) levels, and urinary CPR levels, were measured.</p> <p>Results</p> <p>The mean 24-hour blood glucose level was significantly lower in patients taking vildagliptin than sitagliptin (142.1 ± 35.5 vs. 153.2 ± 37.0 mg/dL; p = 0.012). In patients taking vildagliptin, MAGE was significantly lower (110.5 ± 33.5 vs. 129.4 ± 45.1 mg/dL; p = 0.040), the highest blood glucose level after supper was significantly lower (206.1 ± 40.2 vs. 223.2 ± 43.5 mg/dL; p = 0.015), the AUC (≥180 mg/dL) within 3 h was significantly lower after breakfast (484.3 vs. 897.9 mg/min/dL; p = 0.025), and urinary CPR level was significantly higher (97.0 ± 41.6 vs. 85.2 ± 39.9 μg/day; p = 0.008) than in patients taking sitagliptin. There were no significant differences in plasma HbA1c, GA, 1,5AG, IRI, CPR, BNP, or PAI-1 levels between patients taking vildagliptin and sitagliptin.</p> <p>Conclusions</p> <p>CGM showed that mean 24-h blood glucose, MAGE, highest blood glucose level after supper, and hyperglycemia after breakfast were significantly lower in patients with type 2 diabetes mellitus taking vildagliptin than those taking sitagliptin. There were no significant differences in BNP and PAI-1 levels between patients taking vildagliptin and sitagliptin.</p> <p>Trial registration</p> <p>UMIN000007687</p> http://www.cardiab.com/content/11/1/92VildagliptinSitagliptinContinuous glucose monitoring (CGM)Brain natriuretic peptide (BNP)Plasminogen activator inhibitor-1 (PAI-1) |
collection |
DOAJ |
language |
English |
format |
Article |
sources |
DOAJ |
author |
Sakamoto Masaya Nishimura Rimei Irako Taiga Tsujino Daisuke Ando Kiyotaka Utsunomiya Kazunori |
spellingShingle |
Sakamoto Masaya Nishimura Rimei Irako Taiga Tsujino Daisuke Ando Kiyotaka Utsunomiya Kazunori Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) Cardiovascular Diabetology Vildagliptin Sitagliptin Continuous glucose monitoring (CGM) Brain natriuretic peptide (BNP) Plasminogen activator inhibitor-1 (PAI-1) |
author_facet |
Sakamoto Masaya Nishimura Rimei Irako Taiga Tsujino Daisuke Ando Kiyotaka Utsunomiya Kazunori |
author_sort |
Sakamoto Masaya |
title |
Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) |
title_short |
Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) |
title_full |
Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) |
title_fullStr |
Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) |
title_full_unstemmed |
Comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (CGM): Crossover pilot study (J-VICTORIA study) |
title_sort |
comparison of vildagliptin twice daily vs. sitagliptin once daily using continuous glucose monitoring (cgm): crossover pilot study (j-victoria study) |
publisher |
BMC |
series |
Cardiovascular Diabetology |
issn |
1475-2840 |
publishDate |
2012-08-01 |
description |
<p>Abstract</p> <p>Background</p> <p>No previous studies have compared the DPP-4 inhibitors vildagliptin and sitagliptin in terms of blood glucose levels using continuous glucose monitoring (CGM) and cardiovascular parameters.</p> <p>Methods</p> <p>Twenty patients with type 2 diabetes mellitus were randomly allocated to groups who received vildagliptin then sitagliptin, or vice versa. Patients were hospitalized at 1 month after starting each drug, and CGM was used to determine: 1) mean (± standard deviation) 24-hour blood glucose level, 2) mean amplitude of glycemic excursions (MAGE), 3) fasting blood glucose level, 4) highest postprandial blood glucose level and time, 5) increase in blood glucose level after each meal, 6) area under the curve (AUC) for blood glucose level ≥180 mg/dL within 3 hours after each meal, and 7) area over the curve (AOC) for daily blood glucose level <70 mg/dL. Plasma glycosylated hemoglobin (HbA1c), glycoalbumin (GA), 1,5-anhydroglucitol (1,5AG), immunoreactive insulin (IRI), C-peptide immunoreactivity (CPR), brain natriuretic peptide (BNP), and plasminogen activator inhibitor-1 (PAI-1) levels, and urinary CPR levels, were measured.</p> <p>Results</p> <p>The mean 24-hour blood glucose level was significantly lower in patients taking vildagliptin than sitagliptin (142.1 ± 35.5 vs. 153.2 ± 37.0 mg/dL; p = 0.012). In patients taking vildagliptin, MAGE was significantly lower (110.5 ± 33.5 vs. 129.4 ± 45.1 mg/dL; p = 0.040), the highest blood glucose level after supper was significantly lower (206.1 ± 40.2 vs. 223.2 ± 43.5 mg/dL; p = 0.015), the AUC (≥180 mg/dL) within 3 h was significantly lower after breakfast (484.3 vs. 897.9 mg/min/dL; p = 0.025), and urinary CPR level was significantly higher (97.0 ± 41.6 vs. 85.2 ± 39.9 μg/day; p = 0.008) than in patients taking sitagliptin. There were no significant differences in plasma HbA1c, GA, 1,5AG, IRI, CPR, BNP, or PAI-1 levels between patients taking vildagliptin and sitagliptin.</p> <p>Conclusions</p> <p>CGM showed that mean 24-h blood glucose, MAGE, highest blood glucose level after supper, and hyperglycemia after breakfast were significantly lower in patients with type 2 diabetes mellitus taking vildagliptin than those taking sitagliptin. There were no significant differences in BNP and PAI-1 levels between patients taking vildagliptin and sitagliptin.</p> <p>Trial registration</p> <p>UMIN000007687</p> |
topic |
Vildagliptin Sitagliptin Continuous glucose monitoring (CGM) Brain natriuretic peptide (BNP) Plasminogen activator inhibitor-1 (PAI-1) |
url |
http://www.cardiab.com/content/11/1/92 |
work_keys_str_mv |
AT sakamotomasaya comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy AT nishimurarimei comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy AT irakotaiga comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy AT tsujinodaisuke comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy AT andokiyotaka comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy AT utsunomiyakazunori comparisonofvildagliptintwicedailyvssitagliptinoncedailyusingcontinuousglucosemonitoringcgmcrossoverpilotstudyjvictoriastudy |
_version_ |
1716750399894978560 |