Modern principles of management of patient safety (systematic review)

The article analyzes the research works devoted to the study of principles of management of patient safety. Used medical databases MEDLINE, Cochrane Collaboration, EMBASE, SCOPE, ISI Web of Science for the period 1991-2017. In most studies a strict sequence of origin of the harm associated with heal...

Full description

Bibliographic Details
Main Author: Y. E. Voskanyan
Format: Article
Language:Russian
Published: Federal State Autonomous Educational Institution of Higher Education I.M. Sechenov First Moscow State Medical University of the Ministry of Health of the Russian Federation (Sechenov University) 2018-09-01
Series:Сеченовский вестник
Subjects:
Online Access:https://www.sechenovmedj.com/jour/article/view/67
id doaj-0109ad0285bb4ec5a42bd8192088dd70
record_format Article
spelling doaj-0109ad0285bb4ec5a42bd8192088dd702021-09-16T17:42:57ZrusFederal State Autonomous Educational Institution of Higher Education I.M. Sechenov First Moscow State Medical University of the Ministry of Health of the Russian Federation (Sechenov University)Сеченовский вестник2218-73322658-33482018-09-0103172410.47093/2218-7332_2018.3.17-2466Modern principles of management of patient safety (systematic review)Y. E. Voskanyan0Russian Medical Academy of Continuous Professional EducationThe article analyzes the research works devoted to the study of principles of management of patient safety. Used medical databases MEDLINE, Cochrane Collaboration, EMBASE, SCOPE, ISI Web of Science for the period 1991-2017. In most studies a strict sequence of origin of the harm associated with healthcare management (adverse event or unintended injury), which is based on constant system of causes - latent threats, is shown. The development of an adverse event begins with the activation of the latent threat and turning it into an active threat of group 1 (dangerous situation), which is the cause of the active threats of group 2 (errors and failures). Active threats of group 2 lead to dangerous events (incidents), which are a potential or real cause of unintended injury. Latent and active threats exist on three levels - personnel, environment and patient. Management of latent threats at all levels is at the heart of patient safety, reducing the frequency and severity of unintended injury.https://www.sechenovmedj.com/jour/article/view/67medical carepatient safetyadverse eventincidentactual threats (actual failures)latent threats (latent failures)medical errors
collection DOAJ
language Russian
format Article
sources DOAJ
author Y. E. Voskanyan
spellingShingle Y. E. Voskanyan
Modern principles of management of patient safety (systematic review)
Сеченовский вестник
medical care
patient safety
adverse event
incident
actual threats (actual failures)
latent threats (latent failures)
medical errors
author_facet Y. E. Voskanyan
author_sort Y. E. Voskanyan
title Modern principles of management of patient safety (systematic review)
title_short Modern principles of management of patient safety (systematic review)
title_full Modern principles of management of patient safety (systematic review)
title_fullStr Modern principles of management of patient safety (systematic review)
title_full_unstemmed Modern principles of management of patient safety (systematic review)
title_sort modern principles of management of patient safety (systematic review)
publisher Federal State Autonomous Educational Institution of Higher Education I.M. Sechenov First Moscow State Medical University of the Ministry of Health of the Russian Federation (Sechenov University)
series Сеченовский вестник
issn 2218-7332
2658-3348
publishDate 2018-09-01
description The article analyzes the research works devoted to the study of principles of management of patient safety. Used medical databases MEDLINE, Cochrane Collaboration, EMBASE, SCOPE, ISI Web of Science for the period 1991-2017. In most studies a strict sequence of origin of the harm associated with healthcare management (adverse event or unintended injury), which is based on constant system of causes - latent threats, is shown. The development of an adverse event begins with the activation of the latent threat and turning it into an active threat of group 1 (dangerous situation), which is the cause of the active threats of group 2 (errors and failures). Active threats of group 2 lead to dangerous events (incidents), which are a potential or real cause of unintended injury. Latent and active threats exist on three levels - personnel, environment and patient. Management of latent threats at all levels is at the heart of patient safety, reducing the frequency and severity of unintended injury.
topic medical care
patient safety
adverse event
incident
actual threats (actual failures)
latent threats (latent failures)
medical errors
url https://www.sechenovmedj.com/jour/article/view/67
work_keys_str_mv AT yevoskanyan modernprinciplesofmanagementofpatientsafetysystematicreview
_version_ 1717378118992265216